CAZyme Information: EPE02543.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE02543.1
• CAZy Family: AA11
• CAZyme Description: Dolichyl-phosphate beta-glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:S3C8L1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435	KE148177|CGC1	47561.80	7.2586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148177:110681-111988(-)

Full Sequence      

MDALDHVGTLFAALAAVPILYLLLGISVLLVTGVGAVYVLLCYIAPKPRLSFASEKTYQT
SDPSSKTGFATRQLPCWYDKWLAERHLADTSKNTKSDDDNVYDLSAIEPAEVGLTVVVPA
YNEALRILPALQEMVDFCDKRFGRPKPAAMLSPTSRKTTPTRMATPRRQKAPAAAVLYDF
PADKKQLPDDRDLPSGYEILIVNDASSDNTVEVALDFAKDRGLHDVIRVITLDKNRGKGG
GVTHGFRHARGAYVVLADADGASRFSDLDKLLEGCDLIVDVSDRGVAIGSRAHLVGSEEV
VQRSALRNFLMKSFHFVLTILTPPATSRIRDTQCGFKLFSRAALPHIVPYMHTEGWIFDI
EMLMLAESAPATPVVAHDGTVIGTSAGIKVAEVPVGWHEVDGSKMNLVQDSIRMAIGLTV
LRASWMLGVYRRRLT

Enzyme Prediction     

No EC number prediction in EPE02543.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	194	274	4e-21	0.45294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	4.50e-86	116	404	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	3.51e-73	92	431	51	322	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	3.58e-48	116	366	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	2.23e-20	197	344	28	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133030	DPM1_like_bac	3.82e-18	197	350	30	165	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAX07652.1|GT2	6.23e-186	22	435	27	415
QBZ58877.1|GT2	6.23e-186	22	435	27	415
AEO55352.1|GT2	2.08e-176	18	435	27	452
QLI64092.1|GT2	1.16e-174	10	435	14	417
QUC17306.1|GT2	1.08e-173	10	435	13	421

PDB Hits     

EPE02543.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40350|ALG5_YEAST	2.39e-66	29	431	18	329	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|O60061|ALG5_SCHPO	3.35e-66	112	432	62	315	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|Q54J42|ALG5_DICDI	1.40e-48	84	431	57	324	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9DB25|ALG5_MOUSE	7.98e-45	70	435	31	320	Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg5 PE=1 SV=1
sp|Q9Y673|ALG5_HUMAN	2.18e-44	114	431	67	316	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000028

TMHMM  Annotations     

Start	End
7	41