CAZyme Information: ELR09772.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR09772.1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	GL573243|CGC1	28826.01	5.2878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573243:45602-46555(-)

Full Sequence      

MNNAGHSTRTILLSKKESGWLIISRRSAGNIDPLAEDKSSGHSHLKAFNIANLTASSPPY
DFTADGRLLGWGIFTVENSADDVARSGTDIHATNPGEEMNFVGTLASSENQAVTTDIPTA
SLQFAADVTDQTPTVTDADCEERVKPRLTFQPHTTPLDVKFAADGGKAFVSFHGSWNSPT
PVGYMVATIDFANGQPVAAADSQTAAVDLFTNPDITKCPNACFKPASLFLDGTGRLYVSS
DATGEIWILGPTGSTTPPANSGGRRRARLPRL

Enzyme Prediction     

No EC number prediction in ELR09772.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	1	249	7.1e-78	0.7007481296758105

CDD Domains     

ELR09772.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI18151.1|AA12	1.17e-74	1	265	153	452
UPK97414.1|AA12	6.10e-73	1	254	148	434
ETS00347.1|AA12	4.17e-70	1	249	148	427
QKD50391.1|AA12	5.41e-70	1	249	144	429
QYT00796.1|AA12	6.28e-69	1	255	146	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	9.06e-73	1	249	121	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	9.31e-73	1	249	122	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	9.56e-73	1	249	123	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	1.24e-30	1	249	119	408	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

ELR09772.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ELR09772.1.