CAZyme Information: ELR09584.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR09584.1
• CAZy Family: GT32
• CAZyme Description: Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:L8G9R9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		48101.53	9.5693

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573239:52607-54024(-)

Full Sequence      

MVTTAQLYGRAIDLATNPAHSRWQSPILLVVDALLCLVIIWKVPYTEIDWEAYMQQVAQF
LSGEHDYVKIAGGTGPLVYPAVHVYIYSGLYWITDKGRDIKLAQGIFAALYLLTLGGVMA
CYRRAKAPPYIFPMLILSKRLHSIYILRCFNDCFVVLFLWMAIYAYQRRAYTTGTIIYSL
GLGVKMSLLLVLPAIGIVFLLTNGVWTGLQQATIMAQLQVLFSTPFALENVRGYYGRAFE
FSRVFLFKWTVNWRFIGEEVFLSKGFSTALLLGHINVLAIFAVTRWLKTAGRPIETMITR
TLRLQEPLGNVQNLVSQRVTPQYVLTTILTANVIGILFARSLHYQFYAYLAWSTPFLLWR
SGMHPILQYALWAAQEWAWNVYPSTDLSSQVVVGVLALTVAGVWWGTGREEYAEIRPGAR
DDVK

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	26	389	3.7e-146	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	26	389	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ55924.1|GT58	2.21e-187	21	419	37	435
CCD52739.1|GT58	8.93e-187	21	419	37	435
APA13132.1|GT58	3.62e-186	21	421	37	437
QSZ28550.1|GT58	5.96e-184	4	407	15	419
AEO60805.1|GT58	3.83e-182	21	412	41	432

PDB Hits     

ELR09584.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	5.70e-176	7	424	14	435	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	2.38e-143	13	403	9	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	1.71e-142	13	417	71	467	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.02e-138	2	403	6	399	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	1.90e-134	13	403	9	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000008

TMHMM  Annotations     

Start	End
26	48
70	92
105	122
144	166
187	209
265	287
323	342
387	406