CAZyme Information: ELR09488.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR09488.1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37539.30	7.2324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573175:92150-93191(+)

Full Sequence      

MRKGTKVFILVNFVVICLLVNVFSTLIALLFEDGTVHAIPAADIMRPSEDHTDRNDRQVI
PRIIHQTYVNDSIPAQWVPSQRSCIDLHPDYEYKLWTDTLSREFIRTKYPWFLDTFDSYP
FPIQRADAIRYFILDHYGGIYLDLDDGCVRRLDVMLEYPAWLRRTLPTGISNDAMGAIPH
HPFFERVIQSLERYANNYGMPYITVMSSTGPLFLSIIWKQYMSEERPEQDHVRVLMPPEY
RNNAWSIFYIAKGNSWHGKDAQTIFWMGKHWMLLTFGGFAVAGVVFAVMFYAWTAWIGTS
KKDKNGPGYILLPRRECVDRMA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	80	156	2.5e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.77e-74	53	293	75	317	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.34e-26	74	156	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD51739.1|GT32	4.77e-149	1	305	1	304
ATZ48182.1|GT32	4.77e-149	1	305	1	304
APA07946.1|GT32	5.54e-148	1	303	1	302
QSZ30681.1|GT32	2.20e-140	1	303	1	302
QSS73535.1|GT32	2.68e-127	1	293	1	292

PDB Hits     

ELR09488.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.37e-94	1	293	1	298	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	7.38e-92	1	305	1	302	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.44e-89	38	292	57	316	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	3.13e-87	55	290	52	288	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.53e-52	48	290	52	292	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.659834	0.340165

TMHMM  Annotations     

Start	End
7	29
271	293