CAZyme Information: ELR09162.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR09162.1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	GL573231|CGC1	54068.94	7.2250

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573231:21929-23565(+)

Full Sequence      

MLPSYASPSPKMLSRHQANAYSKGHPYPQGGTGTFTISPHRFQPRSSPTALRKRRALLIR
LAICLGVGLVFCIFVWPGVSIMPLITLGLPSSGEDFQLETVRYYDLSNVGGTARGWEREE
RILLCAPLRDAESHLPMFFSHLRNLTYPHHLIDLAFLVSDSKDRTLLVLTELLEGLQAEE
DPNQPYGEISIIEKDFGQKVNQDVESRHGFAAQASRRKLMAQARNWLLSAALRPYHSWVY
WRDVDVETAPFTILEDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALMLADT
LDEDAVIVEGYAEYATWRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKAKVFRSGVHFPA
FSFEKHAETEGFGKMAKRMKFSVVGLPHYTIWHLYEPSVDDIRHMEEMEQERLVRENEEK
EKAERAKKLRNSLMTPTASGKRIRRIFKAWLCLRRQRGNKQPLLALLTLERS

Enzyme Prediction     

No EC number prediction in ELR09162.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	362	5.8e-123	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.78e-156	100	362	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ55714.1|GT62	3.36e-270	12	437	1	429
CCD52067.2|GT62	3.36e-270	12	437	1	429
APA12986.1|GT62	5.25e-270	1	437	1	441
QSZ34290.1|GT62	2.18e-267	12	438	1	430
UQC75883.1|GT62	1.01e-253	1	413	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.24e-60	101	398	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	9.79e-162	33	425	12	403	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	7.47e-161	100	411	61	372	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	1.46e-126	90	412	154	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	5.85e-122	94	412	69	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.99e-62	94	396	66	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999786	0.000226

TMHMM  Annotations     

Start	End
57	79