CAZyme Information: ELR09023.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR09023.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	GL573174|CGC1	71749.91	4.7271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573174:241969-244113(-)

Full Sequence      

MRFSNLPRGALPAILFSGCVSAVKFQEYILAPSDRNVQCRDLLNTTNKVENPGALCTASK
NNDGTTFTGDSAITIDFGKNVAGTVQFNVKSVSGDAEFIGFTFTESNMWISTTLSDSANA
VTFDSPLWFPVGAAGAYAADKTHQRGGFRYMSLWHNSTGEMVIDSLSVNFTASPEMANAQ
DYAGYFNSDSEKLNRVWYAGAYTNQLCTSDPAYGNSQNVPGVDWYLNGRLSEGTSVLMDG
AKRDRLVWPGDIAISGPSMFVSTNSLDGVKNGLSALFSMQEASGRLPYNGIGYFLKGHFD
YSFTYHLYTLLDLYDYYTYSGDLAYLEKYWPQYKLGLANTVRLIDSTGMANVDSPNDWLR
SGMGGHNGEANSIFYHTLEKSITLANVLNDTALIPTWTAAMSSIRTALNANLWDPSQNLF
FDNAEDKSATAVHPQDGNSWAIIAGLVTPDRASAISKALADRWVRPFGAPAPEAGKAISP
FASGFEVQAHYLAGAAHRAIDLMEFMWADFMLDDPRMTNSSLIEGYSADGSLHYPPYDND
ARVSHAHGWATSPTSALSFFGAGIQLTSAMGRTWEIHPRLGGLKRISAGYETGLGEFEAQ
WEASGEVVVGSFTTPQGTSGRLVLPKGEGYTVTGVSGVVAPTEKGGNTFVYADLPGGTYE
IALA

Enzyme Prediction     

EC	3.2.1.40:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	69	624	1.5e-82	0.9900793650793651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225990	COG3459	7.77e-07	374	468	763	863	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
379972	Bac_rhamnosid_C	1.47e-04	563	638	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	2.20e-04	181	461	1	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	0.003	272	463	307	514	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
407295	Glyco_hydro_36	0.003	295	469	117	309	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX61461.1|GH78	4.03e-234	8	625	5	622
QSZ29924.1|GH78	9.16e-212	1	625	1	641
APA09184.1|GH78	2.06e-211	15	625	13	637
ATZ51240.1|GH78	4.11e-206	22	625	20	638
CCD42947.2|GH78	4.11e-206	22	625	20	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.36e-18	148	584	273	659	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.16e-07	192	561	195	542	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

ELR09023.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000747	0.999251	CS pos: 18-19. Pr: 0.8440

TMHMM  Annotations     

There is no transmembrane helices in ELR09023.1.