CAZyme Information: ELR08812.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR08812.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	GL573224|CGC1	48011.98	5.1774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573224:108283-109635(-)

Full Sequence      

MKGNLRILLSAVCLSLAVASILISAGYLSASPSSIAFVRKWVDRISPSLTKQVPDSTSTS
GLNGESTLREGNATLLGAAPAYIRAIMAPEDKTFPRLDCPAPQGVRYDCLKANKEQLSFR
AVRPKYFFAIDLYQCADLLPTLLGSVMEVMRFLGPENCALSIIEGRSTDGTFEILKLLCA
DIEGMGASYFFTSSDLNPTAGARIELLAKLRNMAVHPLMSQPDKYDPATTILLNDVAICR
EDIMELLHQRLHQSADMVCAMDWTYAGEHPTFYDVWIARDMAGDTFFHIPPDGSWDSAWN
LFWNNTETRERYLEHRPFQVFSCWNGATVFTAKPTECFQGEPEIFCKELWKAGYGKIAVV
PSVNLEYSNERGKDIKALKGYASQWVAKDGDDPKDTALKIQWVKDPPNLVKCMPNYQEQR
WVPWDESLA

Enzyme Prediction     

No EC number prediction in ELR08812.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	125	334	2.3e-61	0.8535564853556485

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	5.28e-87	125	345	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7199884.1|GT69	3.39e-154	36	428	37	441
UQC84687.1|GT69	9.55e-149	66	428	104	473
QRC99639.1|GT69	3.47e-148	70	428	76	444
UPL02737.1|GT69	2.48e-136	29	428	47	474
AEO64631.1|GT69	7.76e-135	56	427	56	438

PDB Hits     

ELR08812.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	1.06e-44	98	426	109	466	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.768426	0.231586

TMHMM  Annotations     

Start	End
7	29