CAZyme Information: ELR08760.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR08760.1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		92707.00	4.6941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573223:41699-44340(+)

Full Sequence      

MVCITLAAAAILSLSLTPHVTAQDDPSILLGEIGRASNESLLWGPYKPNLYFGVRPKIPK
SLSAGLMWAKVDNFQDVQHNFRHTCEQNEGMVGYGWDEYDVRNGGQQTVHDAGNNIDITT
SFVKIPGGKHGGSWGVRVKGTPREDAPDMLMTAMVFYATLEGLGSLEVENKPDKLGYEGD
VTLKGSSAGLGEYKLLVTKGEGRHPTETHDSYKDKPLDRTMVRSMTAAEENLWQIKPLFY
QELKGQIEGYVEKYTVEAMPPPWQVYTLPNDAGSGNIQMVQKVFEGPFEFDIMFSSGSAT
KEVTSEDLTEGIESASNSFVEKFGDVFDLKAPYNGPKYVQFAKSMFSNLFGGIGYFQGDE
VVDRSYAPEYDEENEGFWEEAAEARAKRREQLEGPFELYTSVPSRPFFPRGFLWDEGFHL
LPIADWDMDVALEIVKSWFNLMDSEGWIGREQILGNEARSKVPPEFQVQYPHYANPPTLF
FILDAFVERLSKPNESAITVEESPKLGQAGLNSAHTDNPEVANQYLQAIYPLLKKQYHWF
RRTQSGDLATYDREAFPSKEAYRWRGRTVQHVLTSGLDDYPRPQPPHPGELHVDLISWMG
VMAKSLKNIATYLGETQDVAEFTRNANGILRNIDDLHWSEKEKTFCDATIDEFEEDVLVC
HKGYISIFPFLTGLIEPDSPRLGAILDLIEDPEELWTDFGIRSLSKSNKFYGTDENYWRG
PIWMNMNYLAVRELLKIAQSSTSPHAKQAGSIYSRLRHNLVSNVYKSWKETGFAWEQYNP
EDGHGQRTQHFTGWTSLVVKIMAMPELEAGKASGEEGHDEL

Enzyme Prediction     

No EC number prediction in ELR08760.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	590	802	1.5e-30	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	304	804	2	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.03e-124	41	261	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	2.15e-09	358	736	221	550	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
215307	PLN02567	0.001	593	779	328	511	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ29262.1|GH63	0.0	15	819	14	819
APA15146.1|GH63	0.0	7	815	12	819
QKX57094.1|GH63	0.0	19	821	450	1253
QRD84190.1|GH63	0.0	12	821	9	817
AAR23808.1|GH63	0.0	19	821	23	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.16e-188	32	802	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	7.32e-139	41	803	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	2.63e-242	32	803	33	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.17e-187	32	802	36	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.82e-139	41	803	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.07e-137	43	803	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	4.61e-132	20	803	72	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999734	CS pos: 22-23. Pr: 0.9773

TMHMM  Annotations     

There is no transmembrane helices in ELR08760.1.