CAZyme Information: ELR08507.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR08507.1
• CAZy Family: GT15
• CAZyme Description: Mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:L8G5U9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	GL573218|CGC1	59805.81	9.9662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573218:10788-12650(+)

Full Sequence      

MWRRAYLLLALVRLYFALSPSYLHPDENFQGPEVIAGQIFSYPVKLTWEFTSENPIRSVF
PLWPVYGLPMLLLKWIWIGNGQGGEVTPAVVFWTLRVLMFLLSFVLEDWAIHELVEKPRH
RSLVILLVASSYVTWTFQAHTFSNSLETILVAWSLVLIQRIVDDKQRTSPFASALLAFLV
VFGFFNRITFPAFLFIPAFRLIPHFARKPLSLLFMVISGLWTLFFAIAIDTEFYSRTHPV
TWSTLFTHPIITPLNNLRYNLATSNLALHGLHPRYAHLLFNLPQLLGPAFLLLFFRPHLS
LRLYSAISGILVLSVFQHQEARFLIPTIPLILSSIRLPAKKSHLKIFAAAWLVFNIIFGV
LMGSYHQGGVVPTQFHLANMEDATHALWWKTYSPPVWLLNGKNEVLTTHDLMGMPGAKMI
YELRALATCGSSSSSNSKSGNNNATGTYLVAPLSSSYLSDYIAENNGTKGGLRFEEVWRY
RMHLNLDDLDFGDDGVWPTLKRVVGRRGLATWRVSRDCSSSSGWRS

Enzyme Prediction     

No EC number prediction in ELR08507.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	6	398	9.7e-77	0.987146529562982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.40e-46	5	397	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI14407.1|GT22	6.75e-262	1	518	1	515
QPH02021.1|GT22	2.79e-259	1	520	1	517
QSZ35572.1|GT22	7.00e-256	3	518	5	510
VDB84331.1|GT22	3.43e-255	1	521	1	513
QLI65346.1|GT22	8.61e-255	1	522	1	519

PDB Hits     

ELR08507.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	2.93e-247	1	518	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q4WTT7|SMP3_ASPFU	3.90e-189	1	516	1	543	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	2.23e-187	1	516	1	539	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q5BAX7|SMP3_EMENI	4.57e-180	1	516	1	538	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.16e-93	11	490	14	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999711	CS pos: 17-18. Pr: 0.9727

TMHMM  Annotations     

Start	End
60	79
89	111
123	142
175	197
210	229
273	295
346	368