CAZyme Information: ELR08092.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR08092.1
• CAZy Family: GH78
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287		31688.72	6.7057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573211:78241-79373(+)

Full Sequence      

MRTARQIATSKDSGSSPNDTDYWQANSFPFVFQNVTSFFKLGGNDVNIYGGGTIDGNGQA
WYDLYAKDIYTLRPVLFGIDGLKNSILSDLVLRYSPEYYHFVANSSNVIFDNINIEEEVT
VQIQRRTRMAGTPTGVQISRFKILTSLIVIIALRLNQNSTNILVQNLVCTGSHGISVGSL
GQYVGQFDIVENFHVYNISMTNASDGARIKVWPNTPPALSGDLKGGGGSGRVSNITYDTM
YINNVDYAIEYDQCYGQKNLTLCLGYPSPLTITDIVFKNFIGKTSTK

Enzyme Prediction     

EC	3.2.1.67:7	3.2.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	16	284	4e-47	0.6892307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.63e-23	42	287	49	280	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215120	PLN02188	1.26e-19	44	286	122	350	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	1.32e-13	16	287	121	371	Probable polygalacturonase
178580	PLN03003	1.16e-10	48	287	117	334	Probable polygalacturonase At3g15720
177865	PLN02218	1.86e-09	42	286	154	384	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA09914.1|GH28	9.22e-129	18	287	129	398
ATZ49852.1|GH28	1.55e-127	18	287	130	399
AAF05088.1|GH28	1.55e-127	18	287	130	399
CCD46689.1|GH28	1.55e-127	18	287	130	399
QSZ29377.1|GH28	7.11e-116	18	287	123	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	3.59e-32	18	287	82	335	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	2.98e-14	40	282	68	293	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
6KVE_A	2.59e-13	31	286	54	302	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	2.59e-13	31	286	54	302	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	6.14e-13	31	286	46	294	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00359|PGLRX_COCCA	1.35e-113	18	287	118	387	Exopolygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGX1 PE=3 SV=1
sp|Q00293|PGLRX_ASPTU	3.74e-108	18	285	112	379	Exopolygalacturonase X OS=Aspergillus tubingensis OX=5068 GN=pgaX PE=1 SV=1
sp|Q27UB3|PGLRX_ASPNG	3.74e-108	18	285	112	379	Exopolygalacturonase X OS=Aspergillus niger OX=5061 GN=pgaX PE=3 SV=1
sp|A2R060|PGLRX_ASPNC	3.74e-108	18	285	112	379	Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaX PE=3 SV=1
sp|B0YDE8|PGLRX_ASPFC	2.75e-107	18	287	113	382	Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pgaX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000019

TMHMM  Annotations     

There is no transmembrane helices in ELR08092.1.