CAZyme Information: ELR08079.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR08079.1
• CAZy Family: GH76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	GL573211|CGC1	49836.69	7.1465

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573211:44341-45633(-)

Full Sequence      

MVSRMELTQSRIRYLLVCAFITAFLLFLANTAAVRSHPAFDKPWGPGGDHPGHNPHHAHH
GHRPHEPPRPPGPPNPLKPPGPPMPLKPPAPPVVADSKPESTTSAVPKDTNAVAPATPAK
TELKDETKYLSIAEAQQFCEFRRFEPWANRDKKRKIYDLVLINRELEWLDIRLGQMYSHV
DYFIIVEAAKTFTDKPKTLYVESNWDRYAPYHDKMIRHTITDEGMKFKTTWERETFSRNA
MVDQVIPFLEGEKKVETDDVIIIADVDEIPRPDTLTAIRNCAIPDAVTLRSRMYYYSFQW
LLRGEDWTHPQAMLWKGKDLTMPADTLRMGAYKQHHMQNAAWHCSYCLKSLSDMVNKVTS
FSHVEFNKPEFRDPEKILNRVRHGLDFFDRENSFFDRVEDNKDIPEFLKEHSDKYAFVVN
RDPPNGNFQD

Enzyme Prediction     

No EC number prediction in ELR08079.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	144	418	8.7e-77	0.9612676056338029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	3.55e-47	147	417	66	340	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX53179.1|GT17	1.37e-119	129	430	53	350
UQC82259.1|GT17	2.54e-106	127	430	296	597
AEO66100.1|GT17	2.06e-89	141	430	58	355
QBZ55398.1|GT17	2.59e-87	139	430	62	366
AEO53918.1|GT17	1.13e-85	134	430	47	354

PDB Hits     

ELR08079.1 has no PDB hit.

Swiss-Prot Hits     

ELR08079.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.378337	0.621650	CS pos: 36-37. Pr: 0.3580

TMHMM  Annotations     

Start	End
12	34