CAZyme Information: ELR07681.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR07681.1
• CAZy Family: GH72|CBM43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	GL573207|CGC1	46801.14	7.3310

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573207:43192-44618(-)

Full Sequence      

MLLPKGGATTWKSARSRFPPSRAVWVFVTRTRFLLGVALFGVVLLTWRSIRASAADMQRF
YCWGPSKSPMHMSANEYSEWTRNLQTPVLFNHHAPIVVNSSSIQRIDMNTFTSTPTAASN
GERVLLLTPLRDASRYLSKYFDLISQLTYPHHLIDLGFLVGDSTDDTLAVLSAELERIQK
RQDSVSFNSVTIIEKDFGAAGIVGMDVDNRHGFKAQAPRRKSMARARNYLLYATMKPEHS
WVYWRDADIAESAPEVLEDLIAHDKDVIVPNIWFHRYKEVDGKMVDVEGRFDYNSWIETD
KGRKLAAKLAKDDILVEGYKEHYDTGRRYMTTEGDYREDKDVEWQLDGIGGVNIVVKADV
HKSGINFPCYAFENQAETEGFAKMAKRAKYEVVGLPNYVVWHIDTDEKPR

Enzyme Prediction     

No EC number prediction in ELR07681.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	370	1.5e-100	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.07e-150	102	371	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ58943.1|GT62	8.41e-215	1	408	1	400
VDB93235.1|GT62	7.97e-214	1	409	2	404
UQC85603.1|GT62	3.09e-210	1	409	1	401
UJO24213.1|GT62	6.45e-210	1	409	1	402
QSZ31654.1|GT62	2.62e-209	1	409	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.61e-62	103	406	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	3.47e-88	89	403	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	5.36e-88	122	403	98	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.12e-70	103	402	73	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|Q00314|VAN1_CANAX	9.47e-68	101	403	74	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	6.24e-67	101	403	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000028

TMHMM  Annotations     

Start	End
33	50