CAZyme Information: ELR07584.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR07584.1
• CAZy Family: GH72|CBM43
• CAZyme Description: Chitin-binding type-1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:L8G482]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		41472.97	5.6368

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573206:15783-17045(-)

Full Sequence      

MKSFFTTFFLATMATTTFAHMEMSDPPPLRSKFNKLATSPDYSMTSPLDASGADFACKGF
LSDLGTAAGGSVASWAAGSEQNFTIVGGASHNGGSCQASLSFDSGKTFKAIHSYIGNCPL
VPKYMFTVPADAKAGPAVFAWTWFNKVGNREMYMNCASVTITAGSGTPAVAFSARPDMFV
ANTGTGCTTLESSDLLFPNPGPDVTNDSAGTAAPVGSCASGSGSGSGSGSGSGKTAPVSV
TPPASVVAPTAPTGFTTSIIPSSTNTGQSGSTNPKTPTGPLTPSTNGECGGPQTCAGSAF
GQCCSKYGYCGVTAGHCGEGCDPTLGTCGSAGAAGTGPNGTAPVVSSGAANATANSFLAV
SNAAGAGTKPEAGEMVTKTETGVVYSTVYVTDKAVATGAQQAAVNDVGGNSTFQTVTRGM

Enzyme Prediction     

No EC number prediction in ELR07584.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	20	207	1.6e-64	0.9685863874345549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	4.25e-12	288	329	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211311	ChtBD1	4.63e-08	287	324	3	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	7.94e-08	288	321	1	34	Chitin recognition protein.
214593	ChtBD1	4.15e-05	287	321	3	34	Chitin binding domain.
211312	ChtBD1_GH19_hevein	2.20e-04	288	321	2	35	Hevein or Type 1 chitin binding domain subfamily co-occuring with family 19 glycosyl hydrolases or with barwin domains. This subfamily includes Hevein, a major IgE-binding allergen in natural rubber latex. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02109.1|AA11	7.45e-82	19	221	19	224
QPC71229.1|AA11	3.38e-81	1	257	1	260
CCT62801.1|AA11	1.43e-80	19	218	18	220
SCB65865.1|AA11	1.59e-80	1	257	1	260
QGI76481.1|AA11	2.37e-80	19	218	18	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	1.03e-26	20	201	1	196	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

ELR07584.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000546	0.999436	CS pos: 19-20. Pr: 0.9712

TMHMM  Annotations     

There is no transmembrane helices in ELR07584.1.