CAZyme Information: ELR07504.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR07504.1
• CAZy Family: GH72
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:L8G3V8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		48267.35	5.2319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573205:69451-70818(-)

Full Sequence      

MRVSFRACGLVLLTVAADVTSAIKVDVHDIASIKAAASKVAYGLAKFYTGNVTNTPETIG
ILGRPYYWWEGGAMWGAFLDYYRLTGDSSYNDIAYQALVSQVGPNHDYMVPMYYKEEGND
DQAFWGFAAMSAAEQDWRAPPSPIPSWLQLTINLWNTQAARWDTLHCGGGLRWQIFEYNN
GYTYKNTVSNGAFFQLSARLARYTGNATYAEWAGKVWDWTRESGLIDDHFNVYDGAGIES
NCVDINRMQFSYSPGIYLYGAATMYNATSGSSLWRERTQGLLVRTNEWFFTPFPNATDIM
WEVPCEGIQACNYDMLSFKAYLSRFMWATSKIAPFTAPAISRVLRASAAGAALACDGSET
GELCGQKWYTGTSDDIFGPGQQMAALEVLQGLLTPQADAPLTARGGKLVTSASPGKAVAG
GEAVVGDVPPAVRWRFRR

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	28	401	3.1e-96	0.9636871508379888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.52e-157	32	386	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.01e-09	66	258	44	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ33152.1|GH76	2.62e-159	10	412	7	404
APA13767.1|GH76	6.03e-158	21	413	21	405
ATZ58062.1|GH76	4.50e-155	21	401	21	394
APA11655.1|GH76	4.33e-139	1	402	1	395
QSZ36627.1|GH76	8.68e-139	19	402	21	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.07e-102	24	402	29	412	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	7.90e-116	12	393	9	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	8.93e-114	6	430	5	418	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.47e-111	23	389	19	378	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.89e-110	1	430	2	420	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	3.51e-101	20	400	24	399	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999749	CS pos: 22-23. Pr: 0.9731

TMHMM  Annotations     

There is no transmembrane helices in ELR07504.1.