CAZyme Information: ELR06215.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR06215.1
• CAZy Family: GH36
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		65817.65	5.8672

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573436:25494-27694(-)

Full Sequence      

MKFPFSSIFDSANLIATLSQVATNGDSLLGTLSAPYMPKFLEDGPLPYGFPWGMATTNHT
DPRHAPNTGKIRPYNFVIERGTLAPDGVQKNGLLINGQFPGPTIEANWGDTFQITVTNNI
TSPEEGTTLHWHGLHQDQTPWFDGIPSVSQCPIAPGSSFTYTFQAGLYGTSWYHSHYSAQ
YADGLFGAMIIHGPAHTHYDYDLGPILLSDHYHTGYFELVKRYIGTRAVPNSDNNLINGK
MDYDCSLTKTNCTPNARLSRFKLVSGKVHRLRLINSGSEAIQRFTIDGHTMTVIANDYVP
IEPYETDVITLGVGQRSDVLVRGTGRPTESFWMRSDISKRCSNTNQPHALAVIHYEESDK
STPTSQATVYNETSCSNDPLNMTKPVFVTAPPPEPDFTQIVDIDFQTNATGSELWTINNQ
SFRANFDHPILLLAKLGNTSYPDDPQWNVYNFGNSTSIRLILRNGIPIMHPMHLHGHSFW
VIAEGVGEWDGVITRPENPQRRDTQIIDWGYPSPGKPSYVVIDFLADNPGVWPFHCHVAW
HVSDGLSMNVMERPDLITERQIPSIMAQTCRDWWQYSGHNVVDEIDSGI

Enzyme Prediction     

No EC number prediction in ELR06215.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	64	375	3.4e-124	0.9775641025641025

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	3.98e-87	71	567	1	537	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	5.48e-76	68	557	20	551	L-ascorbate oxidase
215324	PLN02604	1.33e-75	69	541	22	535	oxidoreductase
259923	CuRO_1_MaLCC_like	2.65e-69	69	192	1	122	The first cupredoxin domain of the fungal laccases similar to Ma-LCC from Melanocarpus albomyces. The subfamily of fungal laccases includes Ma-LCC and similar proteins. Ma-LCC is a multicopper oxidase (MCO) from Melanocarpus albomyces. Its crystal structure contains all four coppers at the mono- and trinuclear copper centers. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
259968	CuRO_3_MaLCC_like	4.39e-66	390	551	1	157	The third cupredoxin domain of the fungal laccases similar to Ma-LCC from Melanocarpus albomyces. The subfamily of fungal laccases includes Ma-LCC and similar proteins. Ma-LCC is a multicopper oxidase (MCO) from Melanocarpus albomyces. Its crystal structure contains all four coppers at the mono- and trinuclear copper centers. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 3 of 3-domain MCOs contains the Type 1 (T1) copper binding site and part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA20447.1|AA1_3	1.80e-275	6	589	5	590
QFF92556.1|AA1_3	3.44e-235	5	589	7	593
ATZ46043.1|AA1_3	3.97e-234	5	589	7	593
QFF92555.1|AA1_3	7.98e-234	5	589	7	593
QSZ30962.1|AA1_3	1.72e-233	17	589	20	595

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SQR_A	1.42e-114	68	589	64	580	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
3V9E_A	2.83e-114	68	589	64	580	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
5LM8_A	9.53e-110	51	580	3	532	Crystal structure of a laccase-like multicopper oxidase McoG from from Aspergillus niger [Aspergillus niger]
5LWW_A	9.81e-110	51	580	4	533	Crystal structure of a laccase-like multicopper oxidase McoG from Aspergillus niger bound to zinc [Aspergillus niger]
5LWX_A	1.07e-109	51	580	31	560	Crystal structure of the H253D mutant of McoG from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A067XMP2|PTAK_PESFW	1.01e-202	45	589	38	585	Oxydoreductase ptaK OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=ptaK PE=2 SV=2
sp|Q96WM9|LAC2_BOTFU	2.20e-116	52	589	49	581	Laccase-2 OS=Botryotinia fuckeliana OX=40559 GN=lcc2 PE=2 SV=1
sp|J5JH35|OPS5_BEAB2	5.68e-116	42	589	45	590	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1
sp|Q0CCX6|GEDJ_ASPTN	1.20e-108	57	589	46	605	Dihydrogeodin oxidase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=gedJ PE=1 SV=1
sp|Q4WQY8|TPCJ_ASPFU	1.61e-106	57	589	46	609	Oxidoreductase tpcJ OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpcJ PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000033

TMHMM  Annotations     

There is no transmembrane helices in ELR06215.1.