CAZyme Information: ELR05296.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR05296.1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	GL573380|CGC1	27805.15	8.4353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573380:1954-2763(-)

Full Sequence      

MSLRLYRTHPILFYGIIFGILMLYYFHTLICTTYSLLSLNFNWPRDAPDFLISSNADRDA
FDLSFANYSRTQDSAGPLYRDLVPPVLHHIALGGHKPQGKWIDARNACLELHPGWEAMLW
TDENAGDFVRERFPELLNMWEQYGYLIQRIDALRYLVLYEYGGVVLDMDLKCTRSLGPLR
RFSFVAPAAHPTGFSIGFMMASKRNEFVGKLVRSLKMYNRRWLGFPYPTVMFSTGCHYAS

Enzyme Prediction     

No EC number prediction in ELR05296.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	104	180	6.5e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.31e-22	64	235	62	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.93e-15	101	179	4	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68738.1|GT32	4.71e-97	4	240	9	244
UKZ53116.1|GT32	1.98e-94	7	240	17	249
QLI72858.1|GT32	3.49e-93	7	240	14	246
UKZ97012.1|GT32	5.45e-93	26	240	36	249
QPH09562.1|GT32	1.41e-92	29	240	36	246

PDB Hits     

ELR05296.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.14e-31	83	235	57	207	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	1.26e-31	82	235	54	205	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.02e-31	82	235	61	212	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.22e-30	50	235	34	218	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	2.02e-23	82	235	81	232	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000043

TMHMM  Annotations     

Start	End
12	34