CAZyme Information: ELR04954.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR04954.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667		71832.87	6.4000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573170:250871-253245(+)

Full Sequence      

MNVPLELLQVVTSAMCSIPLMTNPGRPSMPHDYTIKGPFNAPGISGEMGRLPSNGVGWYR
RSLTLTAEDIAAGRSTFLDIDGAMSYSAVWILPDILNALDSSRYYPGAGIYRNIWLVKAD
ATHVGQFGTFITTPTVTKKSASLDLTVEVENQRSTSQKITISTKVYEFDPLTKKAKGKAV
GTFPDVTVEVAAGAKGSADSSATVKNPKLWGPAPAQKPNLHVAITTLSVSGVKIDTYETQ
FGIRSVVHDAIKGVLINDEAVRIQGTCNHHDLGSLGAAFNIRAGERQLQMLQEMGGNALR
TSHNPPAPELLDLSDRLGMIALDEIFDTWNWHEPDLRAFIRRDRNRPSIIAWSIGNEIPN
QSNPATGKIAQELRNIVREEDLTRPVTQGMNNAKAADLTAQVMDIEGLNYQGEGHGTDTS
STFPSFRVAFPDKLIYTSESASTVSSRVITHHPPWSESAKVFGPDSGEDVEARHLSDYGL
YEPSWGASPDKVFAAQDEHPYVAVHVFSAADEAELFVNGKSAGRVKSGKSSNRFRWDDVI
YQPGDLRVVTYKNGKKWAEDIKRTVGSATKLAISADRSAIGLDDDLSFISIAVIDSKGDT
VPRASNSITFSISGPGTIVSTDNGDPTDMTAFPSLTRKATGAGAITVSATADGITGAKVT
LKALLVK

Enzyme Prediction     

EC	3.2.1.23:2

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	7.88e-45	97	387	157	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.18e-32	108	405	168	463	beta-D-glucuronidase; Provisional
408349	Glyco_hydro2_C5	1.79e-27	571	660	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
406696	DUF4982	4.55e-22	504	560	6	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
236673	ebgA	1.76e-20	52	413	105	501	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD01710.1|GH2	1.56e-240	29	663	113	875
AEO59435.1|GH2	2.96e-239	29	663	116	880
QRD03755.1|GH2	1.09e-236	28	663	113	880
AEO71826.1|GH2	2.18e-221	29	661	97	861
CAE7211356.1|GH2	8.42e-216	28	662	137	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	1.27e-99	28	661	58	818	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	2.01e-90	28	661	37	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	9.55e-90	28	639	43	771	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	9.93e-75	29	654	41	844	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	1.48e-74	29	654	64	867	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	6.91e-95	29	639	76	812	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	6.72e-53	28	630	79	774	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	1.67e-26	109	615	183	737	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	5.53e-21	93	358	177	431	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	9.93e-19	109	619	148	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ELR04954.1.