CAZyme Information: ELR04913.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR04913.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	GL573170|CGC2	44388.21	6.4029

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573170:96598-97859(+)

Full Sequence      

MLTFRRAVAAAALILTILYLFTHTHSDTSLLPLSSAAAEKQHGTEHASTTASHPKDDISK
PSQASSNSKKPSSQRPLVDPSTLSLPDKLAYHFPYDLPTKFPAYIWQTWKHTPASGNFAE
TLRPAEASWSEKHPGFVHEVVTDAVALHLLRYLYAALPEVLQAYEALPLPILKADFFRYL
ILLARGGIYTDIDTHALRSALDWIPASVPHEAVGLVVGIEVDATDREDWAEWYSRRIQLC
QWTIQAKPGHPVLRSIVARITAETLRRQKAGALHVSDDKVVEFTGPAVWTDAVFDFFNDE
KYFEGVRNITWRDFTGMKGPKKVGDVVVLPITSFSPGVQTMGSGEYDDPMAYVKHEFEGS
WKPENLRHIGIVYDGTENEQIEAQQKTQQEAQAQKQA

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	126	205	8.2e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.74e-45	84	362	65	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.57e-19	128	205	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52760.1|GT32	3.35e-164	1	370	1	375
CCD51914.1|GT32	3.35e-164	1	370	1	375
APA11100.1|GT32	5.84e-164	19	372	3	361
QBZ65877.1|GT32	1.14e-163	1	370	1	374
AEO65653.1|GT32	7.70e-159	1	370	1	379

PDB Hits     

ELR04913.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.47e-84	14	366	18	380	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.86e-71	88	362	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.06e-67	80	362	109	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.67e-62	84	370	79	478	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.174643	0.825329	CS pos: 26-27. Pr: 0.7868

TMHMM  Annotations     

Start	End
7	24