CAZyme Information: ELR04909.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR04909.1
• CAZy Family: GH16
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:L8FWJ7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	GL573170|CGC2	48276.33	4.8313

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573170:77682-79207(-)

Full Sequence      

MLLTTLVSSAWLLLGGARVASAIELNIDDDQSIRNAASTIVYDMMLEYKGNLSGQTPGLL
PGPPPTPLVLNAGYFWWEAGAMFGSLLDYWYYTGDDSYNAVIKQALIHQSGDHFDYLPQN
QSLGMGNDDQGFWGMSAMTAAEFNFENPAADEPQWLALAQAVFHTQAERLDPKTCGGGLH
WQAYSYLNGYSYKNSISNGCFFNIGARLALYTNNATYAKYATETWEWMSSVGFLDKDYNI
YDGGDQKDNCTEINRVPFSYNAGIFLHGAATMYNYTDGSAIWKDRVEKLLARTIEVFFPN
GIAFELACETDLSCSVDMYAQKAFLTRWMAASTKIAPFIYDTVMKPLRTSAAAAALQCSG
APTGRVCGLSWSKKAAWDGTHGVGQQMAALEVIQSMLIKKARSIVSNATGGTSMGNPNAG
NDVVDYSKMTPATTGGRWGRGS

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	403	4.2e-99	0.9441340782122905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.54e-161	32	390	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.27e-05	176	302	133	253	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ53131.1|GH76	2.39e-189	12	441	13	443
APA11453.1|GH76	9.69e-189	6	441	7	443
QSZ36850.1|GH76	5.69e-183	4	441	11	443
VCU41163.1|GH76	4.86e-178	21	441	19	438
CCD34628.1|GH76	4.71e-176	44	441	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.91e-137	16	420	18	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	7.74e-119	18	420	17	408	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.24e-118	1	420	1	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	1.09e-113	23	420	22	410	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	3.72e-113	23	420	19	405	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q05031|DFG5_YEAST	9.92e-108	18	420	22	415	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999771	CS pos: 22-23. Pr: 0.9500

TMHMM  Annotations     

There is no transmembrane helices in ELR04909.1.