CAZyme Information: ELR03557.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR03557.1
• CAZy Family: CE4
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:L8FRP6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		48529.86	9.6580

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573183:224606-225986(+)

Full Sequence      

MGTKSTWFGPVPVFSAAIILRIGLFLYGLWQDANSPMKYTDIDYYVFTDAARYVATNHSP
YDRETYRYTPILSWLLLPTTWQGDWFSFGKALFALSDIITGWLIVLVLRTTGGMPMDRAL
KFASIWLLNPMVATISTRGSSEGLLAAMTVALVWAVMQRRIVLASVLLGVGVHFKIYPFI
YAPSIVWWLDDEQLQLRPKSTQESSLWNRARRFCNKPRIMLAFLSFGTFIALNWAMYYMY
GSPFLHHTYLHHVTRVDHRHNFSPYNTILYLSSTASTPSYMHLETLAFIPQLFLSAIALP
LLLAKKDLPSTMLAQTFSFVTFNKVCTSQYFLWYMVFLPFYLPTSSLVASPRLGITALVL
WVLTQAMWLQQGFDLEFLGKSTFVPGLWMASQAFFLTNSWILGIIVSDIGGKARAFPTPQ
TISITE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	405	4e-94	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	2.17e-86	5	406	3	415	GPI mannosyltransferase
252941	Mannosyl_trans	7.11e-75	135	406	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR53900.1|GT50	8.55e-188	1	423	1	418
SMY24427.1|GT50	8.55e-188	1	423	1	418
SMR52675.1|GT50	1.56e-185	1	423	141	558
SMQ50759.1|GT50	1.91e-185	1	423	147	564
QDS69008.1|GT50	4.77e-180	10	409	8	407

PDB Hits     

ELR03557.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7W0|GPI14_EMENI	9.02e-176	4	411	2	430	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.24e-174	10	409	8	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q7S4Z3|GPI14_NEUCR	2.37e-174	5	412	20	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	2.44e-171	10	413	8	425	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	2.79e-162	1	408	1	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000001

TMHMM  Annotations     

Start	End
7	29
86	108
219	241
281	303
330	364
384	406