CAZyme Information: ELR03072.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR03072.1
• CAZy Family: AA7
• CAZyme Description: 1,4-alpha-D-glucan glucohydrolase [Source:UniProtKB/TrEMBL;Acc:L8FQ85]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		72540.71	7.3736

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573303:29357-31644(+)

Full Sequence      

MAPLSRRVQDSNPLYKSYEGALHSGPSSSPIPLRLFHNPFTIKFIMFGLGPALLVSLLAF
QNALALPGTSRAHIEKRDLDSWITTQSPYSLTKLLCNIGAAGCNAQGAASGAVVASPSKT
SPNYWYTWSRDSALVSKYLVDKLGNGYHASLQAKIQNYIIAQANLQGVTNPSGSLDTGAG
LGEPKFNVDLTAFTDNWGRPQRDGPALRAEVLIGYGNWLVDNGYSATAVSAIWPVLVNDL
AYVVQYWNQGGFDLWEEVNGNSFFTTASQHRALVEGIAFAARIGKSCNNCATVAPQILCY
QQNYWTSNGNYIVSNINVNNGHTGKDANSILTSIHSFDPAGGCDAATFQPCSDRALANHK
AVTDSFRSVYSINSGIAQGAAVAVGRYSEDTYYNGNPWYLATFAAAEQLYDALYQWNSVG
AIAITDVSLAFFKDLYSSAAVGTYQKSSTQYTAIVAAVKTYADGYMTKAQAYTPSSGALA
EQYDRSSGSPLSAADLTWSYAAFLSASDRRAGIVPASWGSINGNTVPAGTCGNSAFTGSY
SKASGITFPANQTPGTAGPTSTATATATVTSSVPTSTSCVIAHKVAVTFNEVVTTVVGQT
VKIVGSISQLGSWNTANAIALSASGYTSSNHLWSTALNLPSGTTFQYKFINVASNGAVTW
ESDPTRQYTVPATCDTTATVSSNWK

Enzyme Prediction     

No EC number prediction in ELR03072.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	95	506	2.7e-73	0.9806094182825484
CBM20	585	676	3.5e-26	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	2.35e-139	90	507	3	416	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	5.53e-44	579	684	1	106	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
395557	CBM_20	1.29e-32	585	680	1	95	Starch binding domain.
99883	CBM20_alpha_amylase	5.59e-26	585	685	1	95	Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in several bacterial and fungal alpha-amylases including the maltopentaose-forming amylases (G5-amylases). Most alpha-amylases have, in addition to the C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13, which hydrolyzes internal alpha-1,4-glucosidic bonds in starch and related saccharides, yielding maltotriose and maltose. Two types of soluble substrates are used by alpha-amylases including long substrates (e.g. amylose) and short substrates (e.g. maltodextrins or maltooligosaccharides). The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
119437	CBM20	3.99e-20	603	684	18	96	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ31699.1|CBM20|GH15	6.51e-269	45	685	30	676
APA12357.1|CBM20|GH15	4.04e-263	45	685	30	678
ATZ49247.1|CBM20|GH15	8.98e-263	45	684	27	672
ATZ49248.1|CBM20|GH15	8.98e-263	45	684	27	672
CCD49819.2|CBM20|GH15	1.39e-262	50	684	5	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VN4_A	2.09e-241	79	685	2	598	Chain A, GLUCOAMYLASE [Trichoderma reesei],2VN7_A Chain A, GLUCOAMYLASE [Trichoderma reesei]
6FRV_A	6.53e-227	79	685	3	616	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
3EQA_A	5.05e-199	79	550	3	468	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]
1AGM_A	6.13e-195	79	550	3	467	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
1GAH_A	6.35e-195	79	550	3	467	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14804|AMYG_NEUCR	4.47e-259	52	685	6	626	Glucoamylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gla-1 PE=1 SV=3
sp|P36914|AMYG_ASPOR	4.46e-228	79	685	30	612	Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=glaA PE=2 SV=2
sp|P69327|AMYG_ASPAW	8.32e-228	58	685	1	640	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P69328|AMYG_ASPNG	8.32e-228	58	685	1	640	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P22832|AMYG_ASPUS	7.45e-226	58	685	1	639	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999775	0.000242

TMHMM  Annotations     

Start	End
44	66