CAZyme Information: ELR01802.1

Basic Information

• Species: Pseudogymnoascus destructans
• Lineage: Ascomycota; Leotiomycetes; ; Pseudeurotiaceae; Pseudogymnoascus; Pseudogymnoascus destructans
• CAZyme ID: ELR01802.1
• CAZy Family: AA1
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:L8FLJ0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
134	GL573178|CGC1	14247.52	8.1324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Pdestructans20631-21	9225	658429	150	9075

• Gene Location: location=GL573178:86666-87156(-)

Full Sequence      

MNASSICPLLAAAALVGLAAAKSKIKIVPLGDSITEITCWRTCLWDDLQADGVTNSFETA
RAIRAGTCTIHEGHSGYLAINIANTNLQGWLASAKPDVVMFMLGTNDVSQGKSSTVIMAS
YTKMVQLMRASNRI

Enzyme Prediction     

No EC number prediction in ELR01802.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	25	132	5.2e-25	0.5773195876288659

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.61e-19	25	132	1	77	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.77e-10	30	132	2	98	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	7.17e-08	27	132	1	104	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	6.67e-07	27	133	2	86	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	2.31e-06	24	128	1	94	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81372.1|CE3	2.40e-41	21	132	18	139
VBB79507.1|CE3	4.24e-33	10	132	73	205
CDP27869.1|CE3	4.24e-33	10	132	73	205
CAP61514.1|CE3	4.24e-33	10	132	73	205
AEO59370.1|CE3	2.71e-31	24	132	30	148

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	8.26e-28	25	132	2	119	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	2.32e-27	25	132	2	119	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
2VPT_A	2.64e-08	21	108	2	96	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

ELR01802.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000434	0.999554	CS pos: 21-22. Pr: 0.9614

TMHMM  Annotations     

There is no transmembrane helices in ELR01802.1.