CAZyme Information: EKG22493.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG22493.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	AHHD01000008|CGC2	34365.58	5.0133

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000008:234246-235451(-)

Full Sequence      

MQPTCGLSYLAILLQLASHSVSALTGKDNPCAASYSAIIAFGDSLSDTGNGSWKISNATW
PANPNYYGGRFSNGLVWIEYVAANLSIPLYNYAVGGATTSNSLVQGYTGPGSSIPVPSVQ
DQVSNFLKHSSSDIPDASPLFVLFGGANDVLFNPNVTAAQSYQEIMASRSALLAHFPNAT
FMVLDYPDLSRIPYAYYITRLDKHIIRAFSQGLTKLYADLSSDCMTDGSSRLIFVNLPQL
FNQWEYYAEPRDYGFDALGAYGSCLVGVYKETETVSLCSDPSSKVFWDEYHPTTRAHSFI
AEKVLDALGSSGRCRM

Enzyme Prediction     

No EC number prediction in EKG22493.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	39	304	1.5e-23	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.95e-63	38	307	2	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.07e-25	37	307	2	314	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	3.02e-25	35	308	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	1.12e-24	11	308	5	333	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
185279	PRK15381	2.87e-13	36	195	143	292	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61065.1|CE0	2.89e-51	33	308	26	296
QPC72470.1|CE0	1.25e-49	38	302	31	290
QPC63584.1|CE0	1.76e-49	38	302	31	290
UPL02629.1|CE0	3.67e-47	35	313	26	299
UJO20625.1|CE0	5.89e-47	7	308	3	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JL1_A	2.10e-24	38	305	147	407	Crystal structure of VvPlpA G389D from Vibrio vulnificus [Vibrio vulnificus]
6JL2_A	1.01e-23	38	305	147	407	Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_B Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_C Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus]
6JKZ_A	1.89e-23	38	305	147	407	Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus],6JL0_A Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus]
6UQV_A	1.67e-11	29	302	3	279	Crystal structure of ChoE, a bacterial acetylcholinesterase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],6UQW_A Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQW_B Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQX_A Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1],6UQX_B Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1]
6UR1_A	4.12e-11	29	302	3	279	Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1],6UR1_B Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99289|HLT_VIBPA	4.93e-23	38	307	147	409	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2
sp|P10480|GCAT_AERHY	3.60e-11	23	302	13	320	Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila OX=644 PE=1 SV=3
sp|Q94CH8|EXL1_ARATH	1.09e-09	37	306	52	368	GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana OX=3702 GN=EXL1 PE=2 SV=1
sp|Q9M2R9|GDL58_ARATH	1.96e-09	23	305	24	356	GDSL esterase/lipase At3g50400 OS=Arabidopsis thaliana OX=3702 GN=At3g50400 PE=2 SV=1
sp|G2QJ27|AES1_MYCTT	8.41e-09	31	307	27	296	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999785	CS pos: 23-24. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in EKG22493.1.