CAZyme Information: EKG22184.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG22184.1
• CAZy Family: GT8
• CAZyme Description: Glycosyl transferase family 39

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770		88151.18	9.4590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000028:170445-172861(-)

Full Sequence      

MSSQPSTAARYRGRDKKRPATPNPDSPAEKINGAVSRAHSEAAAKIGSEWDYKIALAVVT
LLGFWTRFWGITHPDQVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFAGWLVGYDG
SFLFENIGDSYVTNKVPYVAYRALPATLGALTVPTVFLIMWESGYSLPACLTATALVLFD
NAHVGQTRLILLDATLIFFMALSVLCYIKFYKMRHVPFSRKWWKWLLLTGVCLSCVISTK
YVGLFTFFSIGVPVAFDLWDLLDINRRQGSLSLPDFGKHFAARLTALIVIPFFLYLFWFQ
VHFSILTRSGPGDDFMSPEFQETLSDNIMTMQSVSIDYFDAITMRHKETKVYLHSHPDRY
PLRYDDGRISSQGQQVTGYPHNDTNNHWQILPATDPVDKPRRVKNGDLVRFRHLVTNTIL
LTHDVASPYYPTNQEFTTIDIETANGERFNDTVFEIKIENGKPGQDFKSMGSHFKLIHWP
TKVAMWTHTTPLPDWAYRQAEINGNKNVQQSSNVWYVDEIPSLAADDARRIQEPRKVKTL
PFLRKYFELQRAMFFHNNALTSSHPYSSFPISWPFLLRGVSFWTENDTRQQIYFLGNPLG
WWLASSLLAVFAGIIGADQLALRRGVDALDQRTRSRLYNSTGFFFLTWAAHYIPFFIMGR
QLFLHHYLPAHLASALVTGALVEFIFNIEPPTPEEIENKKRKGTARSSRPVRERLGGQTM
YASWAATGVIVAVVVWSFFFFAPLTYGKPGLDVPQVLARKWLNYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	59	303	2.2e-73	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	51	770	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.14e-87	57	307	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	7.81e-80	544	763	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	4.46e-16	354	510	13	168	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	3.11e-07	338	393	6	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC97974.1|GT39	0.0	3	770	2	771
QDS68433.1|GT39	0.0	3	770	2	771
UJO12504.1|GT39	0.0	3	770	2	779
CAE7203019.1|GT39	0.0	1	770	1	807
CBX95750.1|GT39	0.0	13	770	65	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.41e-110	53	763	50	725	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	5.22e-91	58	750	70	737	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	2.48e-06	353	442	24	108	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	4.13e-264	49	770	44	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	2.41e-248	52	763	58	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	1.13e-247	19	770	14	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	2.61e-124	56	750	71	735	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	1.90e-120	51	770	36	746	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999703	0.000298

TMHMM  Annotations     

Start	End
54	71
96	118
139	161
189	211
223	245
280	299
593	615
635	657
720	742