CAZyme Information: EKG21755.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG21755.1
• CAZy Family: GT59
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:K2SYQ9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1702		180047.48	6.1828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000038:47269-52770(+)

Full Sequence      

MTVITDSYGQPQINFANQGNKCTVFSGTALFYCSELEEDITTCQQTHGKTITLSIGGATY
SEGGFSSTSEAQAAAELVWATFGPNQNKSITSDGTKIYRPFGDASVDGFDFDFESTVSNM
APFAQALRSLMDATEATDGKHRLLTAAPQCPFPDAADDQFLSGALAVKMDAVFVQFYNNY
CGVQSFVSGSSTQNNFNFEAWDKWAKSSKNPAVKVFLGVPASSTAAGSGYLSTSALKPII
DYCMTFPSFGGVMMWDVSQAYANSGFLAAIKHQKPGYCLDYSLQLKLVIGSDGIDIERHQ
HAEPRYASHVERHFHQFVRANNGKSMYTSSEQDFDCFLYEYTCRVEQFKQDNLYKPDGIQ
HAYKQLCRYFFYRNRGSLFQWNFHHLEHLPDQFRPTFNVSTTGLSLPSFNLSTGLPSRIS
LNFSTGFSSPTSFNNVTRDPVSTAVSSSVILRSTAQSSGAELPVSSSGIYLNTTATMTPR
TSVSAVSTDGHSEIMEPSGSAAPTASFTLIAAYNSSSTAPNRFTFFGNTTLPAASATPEP
GRPYSTRSTLSDNSSALSSGISKFPNTTYTDTAPHTVATTESTRNAVPPSSSAIVTFGSS
GVLGTSSYRGTSTEGGRSSEVLLTQNSTGTWTTSNPPMLFSSHAITATAYSTFAGVSGTN
GTVGASQALAPTLMVSMQTSASAKAAGASTGSSDLPKPSLESEPHKMTVSTNPGSSGVSF
STVSSVGLGVTSGSTWSGVSSNTTTSATHSIRTSGVPEIPISTTGAIKGANSSTPSGGIF
QTGVVSNTLGISTSLVTATSSSVISNSARISVITSIVTVTEHAPGVCSNTHSLSAVATMS
SERYVATESPATTAANTHSSTLEIPENAQTSVYTSSKAIPSTSSTWPGTQVISIESQVTP
TTQTPVSTPSTTAPPTTSAPVTLEPYPQVTVQPPWPIPPVANTTSAVVSSPIPVSTCASN
YTYSAVRLCNGKDCNNSIASTNIFAATSDDPPPSNIRRRSDHPVSRSAISADTTGPLHTN
KFYANFFLSEQASGTWTHPYSLSWASGSSGAAQSRGLAISHIDRSQFVFGDTTAHNSSRY
FFAPLGIQSLILSAGELSSSTTLRVSAPTAMSANITLAADGASLPLITFPLVQGMAYVTG
VYRNATPLVESSVYFRSVEGPIKLHPSSNNNSATIKYRALLEDGRTWLIYASPAPGSGYP
VLALANTTRLSGPSGWNGAISVAKLPVNGTTDDEAIYDSAAGVYPVGAEVFGSASGSTGT
YGFNFTRGGYATSSASPLLMFALPHHAASFDASTAGGRTSVTLATTTKGYAVAYRGDAWT
MREALAADLGFAPYSAAKGQSVTALSAGAACAVIDAAAAELAQDVGAQTALDSMYFSGKA
LAKFAAVVYAANDLGGSAELAAEGLKKLKAAFAVFVDNRQPNPLVYDEVWGGVVSNAGYA
DANADFGNSYYNDHHFHYGYFIYTAAVIAYLDPTWLAAGTNKAWTNMLARDFASPVQNSH
YPSSRSFDWFHGHSWAKGLFSSGDGKDQESSSEDAFASYALKMWGKVTGDTAMEARGALM
LAIQARSFQSYFLMTRDNTIQPREIINNKVSGVLFENKVDWATYFGDKWYYKEGIHMIPV
HVPSALIRTAEFVAEEYDTYMSGRRIDEAEGGWRGILQANLALVDAKEAYDYFASANFST
EYLDGGASRTWYLAYTAALAGL

Enzyme Prediction     

EC	3.2.1.14:1	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	1001	1695	4.9e-210	0.9935691318327974
GH18	13	227	4.4e-22	0.5506756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	927	1701	17	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	1360	1693	17	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	4.98e-132	1002	1336	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
119356	GH18_hevamine_XipI_class_III	7.02e-84	9	271	40	279	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	2.14e-14	44	256	59	261	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74901.1|GH81	5.10e-226	980	1701	178	901
QSZ30780.1|GH81	4.53e-225	975	1701	47	760
APA08036.1|GH81	6.38e-222	979	1701	179	888
QRC95614.1|GH81	6.85e-221	980	1702	110	827
CCD51604.1|GH81	2.08e-217	979	1701	155	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.13e-84	993	1697	17	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	6.89e-84	993	1697	42	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.14e-81	993	1697	17	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
2UY2_A	2.99e-42	13	263	48	272	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2XVN_A	1.71e-29	11	263	45	292	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	4.01e-205	978	1697	188	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	3.21e-150	1016	1701	34	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.73e-141	981	1699	45	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	7.69e-131	978	1700	70	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.21e-128	982	1700	401	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000077

TMHMM  Annotations     

There is no transmembrane helices in EKG21755.1.