CAZyme Information: EKG21751.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG21751.1
• CAZy Family: GT58
• CAZyme Description: Glycosyl transferase family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660		74417.75	6.7958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000038:34670-36701(-)

Full Sequence      

MAQQISSNVVGLASHGESPGPMPGKVPLERQRLDSMPVSPNTSGESSEASESIHGSEASS
EAEECTRATIESITENGAAQSSPPDLVPKPSLPEISPTSAFSDPSGSEIDISRAVSPAVV
EPEKEKSGTDIRKPPTNGFFRIKEEFFAIYAPRVEPPLVLPYCPTDTEKYSYLKTNRIPL
YAIGCVSFLSLSAGMWLFVLSSVYFAWFGVLAFLLQLYLFISYLVGIVGRDWDFKNHEKL
LQDYPITEANAPTVDIYLPCCKEPLEILENTYKHIRALEYPKDKLRVYVLDDGAMESVER
LAQQYGFTYMVRDDRPRLKKAGNLRWAFSRTAGDFFVIFDADFCPRPDFIRELLPHHLCN
PKSAIVQSPQFFRTLPEHTWVEQGAGACQELFYRVVQVNRNRWGASICVGSNAVYRREAL
AEVGGTAEIGYSEDVHTGFGAVDRGWTVEYVPLCLAAGVCPDNPRAFFSQQMRWCMGSTT
LLTNPEFWRSKLSFIQKVCYLSGMMYYSALSLSIFINPLPGMLLLWVRPEFFKFYNLAFA
IPSILYGVICLRFWAKASYGLNVQYVMVIQQYAYLNAIKDRLFGNGLAWAPSGDAKAHKN
NKYRNMRILAWGWLIVWESALIAAIVYRILLGLEWWNIIPILVLNVFNFVIAHRFLLCKA

Enzyme Prediction     

No EC number prediction in EKG21751.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	256	423	2.3e-24	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.94e-105	252	482	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	7.49e-42	195	578	2	395	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	3.86e-39	252	524	260	537	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	3.38e-32	256	482	2	232	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133059	CESA_CaSu_A2	7.03e-30	252	478	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO13869.1|GT2	5.70e-265	143	657	316	830
CEI67621.1|GT2	6.19e-265	88	659	87	655
VBB86309.1|GT2	5.97e-264	101	659	86	648
CAP68353.1|GT2	1.20e-263	101	659	86	648
CDP31824.1|GT2	1.20e-263	101	659	86	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	8.27e-37	209	558	233	574	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	9.80e-34	245	537	121	426	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.23e-33	245	537	133	438	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.24e-33	245	537	134	439	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	8.02e-08	232	437	22	225	Mannosyltransferase PcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58931|BCSA_PSEFS	3.08e-39	216	507	126	417	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q93IN2|BCSA_SALTY	9.64e-38	209	558	233	574	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|Q8Z291|BCSA_SALTI	2.30e-37	209	558	233	574	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|P58932|BCSA_XANAC	4.44e-37	216	507	120	411	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	2.08e-36	245	504	142	404	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

Start	End
178	200
205	227
505	527
537	555
609	631
635	657