CAZyme Information: EKG21624.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG21624.1
• CAZy Family: GT4
• CAZyme Description: Six-hairpin glycosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	AHHD01000045|CGC1	41469.23	4.3639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000045:54241-55510(+)

Full Sequence      

MAASIISRGQGVLTGQGDSSELLQAGFTQKAFRQLIQQYPNDPSAGPIDEYIQKSVNSVI
TTVSNATADTGYPLDRLSNGNNLIVKYEETGNATYQDAFEALRQSIDLQARNAEGGLFYY
VYPYWSYLDGMFSLAPFYTLYTNLYDADNTTAVMDDVILQLDLLWQHCRSNATGLLVHGY
DASRTAVWADPVTGASPHVWGRSLGWYMMALIDTLELVPETAKEAQQYLQTRFRELADAV
VRTVDRTSGAWWQLLDQPGREGNYIESSGSAMFAYSLLKGARLGYLEDGPRSNTSGTAAW
TDVATRAFEYVVDKFVVRNVNGTLGYNGTVSVCSLNSTASYEYYVGRPILYNSVLGSAAF
ILASLEYESFVGVPKD

Enzyme Prediction     

No EC number prediction in EKG21624.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	25	368	7.1e-77	0.9457831325301205

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.23e-59	72	368	77	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.67e-56	50	370	52	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92053.1|GH105	5.21e-163	1	368	34	392
QDS73972.1|GH105	4.85e-162	5	368	1	352
CAE7031832.1|GH105	1.24e-157	1	368	1	369
BCS25093.1|GH105	3.19e-140	1	368	35	407
QRD85043.1|GH105	4.68e-128	1	373	45	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.99e-61	50	369	45	360	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.77e-45	74	368	87	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.04e-44	74	368	77	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.93e-08	124	366	155	370	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]
3QWT_A	1.40e-06	149	287	186	314	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.45e-44	74	368	87	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.11e-30	170	366	34	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.11e-30	170	366	34	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999213	0.000831

TMHMM  Annotations     

There is no transmembrane helices in EKG21624.1.