CAZyme Information: EKG21337.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG21337.1
• CAZy Family: GT34
• CAZyme Description: Galactose-binding domain-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688		76328.74	4.5786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000052:134701-136916(-)

Full Sequence      

MANSGLPRVLGSLLLALLAFGAEVLAVLTVDETSSGIVIENDRLHVQLDKSKGVIVGLTL
DDQDLLGPVSGQTGIGPYLDCYCTPSGFYTPGSKAPQYEIFQDIDSSGVPYAGVVMGETY
AATGQLLEFYYFLREGETGLHTFSRLAYYNETTPFLRNLQEFRTLFRPNTQLWTHLATNE
KTYAPLPSRNAVSKQVVVQDATWSLLNTPEDPYVQQWADFFTKYTFQAQWRDHRVHGMFS
DGSTSDTNNTFGAWLVMNTVDTYFNGPKNSDLTVDGIVYNYIASNHHGNGTPNITNGFDR
TFGPFYYHFNSGAPGTTLQESRADALQYADPSWNAQFYDDIAPHVPNYVPTSGRGTWQGA
IALPAASNNQTSTWSRPLAILTASGIDFQDNVADTKAYQYWAELQVSGASNIATVTIPRV
KAGEYRLTVYADGIFGQYTQDGIVVTAGRTTATNASFVEESAGRELWRIGTPDRSSGEYK
HGVEVDTSKPLQPEQYRIYWAKYDFPTEFPEGVRFKVGESKEVEDWNYVHWSSVGGKANA
FRNETLFSPTISNWTILFDASAVELNRSVAEKNEATLTIQLAGAKTAAGNTDVFNATEPY
SNLPYVVTVNGNELEPWVIPYAHSSSCAVRSAISCYNVAHKFVFETKFLKETDNEIVLRL
PSDAMDYESAVLPQQVYVQYDALRLEVQ

Enzyme Prediction     

EC	4.2.2.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	26	673	1.2e-300	0.9968354430379747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	1.53e-56	32	317	5	265	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	7.69e-26	353	455	1	91	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	2.15e-25	467	686	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	2.05e-22	376	451	6	73	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.
405384	CBM-like	2.00e-12	466	685	2	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI80329.1|PL4_3	2.85e-315	14	688	11	670
QGI94046.1|PL4_3	2.85e-315	14	688	11	670
QGI63162.1|PL4_3	2.85e-315	14	688	11	670
CCT67126.1|PL4_3	4.04e-315	14	688	11	670
UPK94230.1|PL4_3	3.55e-313	24	687	19	667

PDB Hits     

EKG21337.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AZ85|RGLB_EMENI	1.53e-266	26	687	18	659	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
sp|A5ABH4|RGLB_ASPNC	3.61e-259	7	676	6	651	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|A1D144|RGLB_NEOFI	3.84e-259	19	687	12	657	Probable rhamnogalacturonate lyase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglB PE=3 SV=1
sp|B0XPA2|RGLB_ASPFC	3.11e-258	19	687	12	657	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglB PE=3 SV=1
sp|Q4WR79|RGLB_ASPFU	3.11e-258	19	687	12	657	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000840	0.999140	CS pos: 26-27. Pr: 0.7994

TMHMM  Annotations     

There is no transmembrane helices in EKG21337.1.