CAZyme Information: EKG20856.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG20856.1
• CAZy Family: PL1
• CAZyme Description: Cytochrome P450

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1165		127439.24	5.0752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000075:46237-50939(-)

Full Sequence      

MPRLFSAAIRLAAVASAFGCVEALTLTVSTSSGNATSPLMYGFMFEDINHSGDGGIHGQL
LRNNGFQGNDQNLTAYAAVGDVDLTVDSDNPLSTAIPYSLAVAVPDGTTGDVGFSNEGYW
GVPVNADQYSTSFFVKGDYSGNVTIRLVGNYTGVEYASTTISGISSNSSAYSYYETSFES
DQAPDGNNLWTLTFDGESTAGSTLHFDLITLYPTTFKSRPNGLKPSIANVLNDVGGSFLR
FPGGNNLEGYSEDNRWKWNETIGPLQDRPGRQGTWGYPNTDELGLIEYMEWCEDMGLAPI
LGVWDGFALESGGNTPITGDALTPYVDEVLNELEFLLGDASSTYGSLRASLGYSSPFNLT
HVEIGNEDYLGGGCESYPERFTIYYNAIHAAYPDITIIASAADASCLPSPLPAGVMQDYH
TYASETDLVANFSQFDHYNRSQPIFVGEFSCYSDASGTRNILPFMACSVAEAVYMIGFER
NADVVLMSTYAPLLQLFNSTQWTPDLIGFTQAPDGVVRSTSYYVQQMFAQNWGTETRAIA
SDSAFGPVYWSASADSSATYVKLANYGANAQNVSEIRKLHLYAMDAISGSYFPTALALNS
ALLGVALHLATFHLYLDNYGWRIAGLWCFSLICAFSMLLRGNDTILAVIQTLSISTAFLL
GFFGSTVLYRLLLSPIRGFPGPWQAAVTNFYRARLAIKSNIRLATDIRAMHQRYGDYVRT
GPREISILNPNAIPILYGARSQCTKGPWYDHDIMMKEEDKSVFLLRDPSLHSFRRRILDR
GFSSKALADYEPRIQEVVNNLIKAFDERSGTPINLTDWISYFTFDAMGRVAYDQDFGMVK
RGQGIVEIDGQTTSVETLHEMIKLFGILGPVPWLIKMIIQMNLSNPLAAFHQWCHHTMKQ
KQQKFNPSTSHHTDMASWLVHSFIHNASSSSSPSSSSSPTKRQTHASLLSDSVLLIIAGS
DTTSSAITTALYHLCRSPSALSTLRAALAALPDTSSRSLASCRYLDAVLNEALRLRPPVC
GALVRETPASGITVPAHGNESRGSPGGVFIPAHTLVAVPTWALHRDPRFWGPDADAFRPE
RFAELGIDVTDERAPFAPFSRGAYACAGKAVAYAEMRAVVAAVVTRFDVEVARAEAEADR
FESGWRDTFTVTNPRLEVVLRKRVE

Enzyme Prediction     

EC	3.2.1.55:10

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410684	CYP67-like	2.12e-132	715	1156	1	417	cytochrome P450 family 67 and similar cytochrome P450s. This subfamily includes Uromyces viciae-fabae cytochrome P450 67 (CYP67), also called planta-induced rust protein 16, Cystobasidium minutum (Rhodotorula minuta) cytochrome P450rm, and other fungal cytochrome P450s. P450rm catalyzes the formation of isobutene and 4-hydroxylation of benzoate. The gene encoding CYP67 is a planta-induced gene that is expressed in haustoria and rust-infected leaves. The CYP67-like subfamily belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410683	CYP57A1-like	8.82e-89	715	1145	1	417	cytochrome P450 family 57, subfamily A, polypeptide 1 and similar cytochrome P450s. This family is composed of fungal cytochrome P450s including: Nectria haematococca cytochrome P450 57A1 (CYP57A1), also called pisatin demethylase, which detoxifies the phytoalexin pisatin; Penicillium aethiopicum P450 monooxygenase gsfF, also called griseofulvin synthesis protein F, which catalyzes the coupling of orcinol and phloroglucinol rings in griseophenone B to form desmethyl-dehydrogriseofulvin A during the biosynthesis of griseofulvin, a spirocyclic fungal natural product used to treat dermatophyte infections; and Penicillium aethiopicum P450 monooxygenase vrtE, also called viridicatumtoxin synthesis protein E, which catalyzes hydroxylation at C5 of the polyketide backbone during the biosynthesis of viridicatumtoxin, a tetracycline-like fungal meroterpenoid. The CYP57A1-like family belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410681	CYP60B-like	7.75e-76	715	1132	1	396	cytochrome P450 family 60, subfamily B and similar cytochrome P450s. This family is composed of fungal cytochrome P450s including: Aspergillus nidulans cytochrome P450 60B (CYP60B), also called versicolorin B desaturase, which catalyzes the conversion of versicolorin B to versicolorin A during sterigmatocystin biosynthesis; Fusarium sporotrichioides cytochrome P450 65A1 (CYP65A1), also called isotrichodermin C-15 hydroxylase, which catalyzes the hydroxylation at C-15 of isotricodermin in trichothecene biosynthesis; and Penicillium aethiopicum P450 monooxygenase vrtK, also called viridicatumtoxin synthesis protein K, which catalyzes the spirocyclization of the geranyl moiety of previridicatumtoxin to produce viridicatumtoxin, a tetracycline-like fungal meroterpenoid. The CYP60B-like family belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410685	CYP58-like	4.14e-62	718	1141	4	410	cytochrome P450 family 58-like fungal cytochrome P450s. This group includes Fusarium sporotrichioides cytochrome P450 58 (CYP58, also known as Tri4 and trichodiene oxygenase), and similar fungal proteins. CYP58 catalyzes the oxygenation of trichodiene during the biosynthesis of trichothecenes, which are sesquiterpenoid toxins that act by inhibiting protein biosynthesis. The CYP58-like subfamily belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410682	CYP_fungal	1.65e-58	715	1135	1	403	unknown subfamily of fungal cytochrome P450s. This subfamily is composed of uncharacterized fungal cytochrome P450s. Cytochrome P450 (P450, CYP) is a large superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop. Their monooxygenase activity relies on the reductive scission of molecular oxygen bound to the P450 heme iron, and the delivery of two electrons to the heme iron during the catalytic cycle.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44900.1|GH51	3.93e-245	21	574	23	570
QMW32872.1|GH51	3.93e-245	21	574	23	570
UDD57939.1|GH51	3.93e-245	21	574	23	570
BCR87727.1|GH51	1.41e-242	21	574	23	570
QRD84401.1|GH51	2.55e-242	21	574	23	577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.53e-125	24	574	1	563	Chain AAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
5VEU_A	4.42e-11	760	1127	94	441	Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_B Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_C Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_D Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_E Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_F Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_G Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_H Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_I Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_J Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_K Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],5VEU_L Human Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],6MJM_A Substrate Free Cytochrome P450 3A5 (CYP3A5) [Homo sapiens],7SV2_A Chain A, Cytochrome P450 3A5 [Homo sapiens],7SV2_B Chain B, Cytochrome P450 3A5 [Homo sapiens],7SV2_C Chain C, Cytochrome P450 3A5 [Homo sapiens],7SV2_D Chain D, Cytochrome P450 3A5 [Homo sapiens]
7LAD_A	4.44e-11	760	1127	95	442	Chain A, Cytochrome P450 3A5 [Homo sapiens]
4RSN_A	1.56e-09	967	1130	278	429	Chain A, Bifunctional P-450/NADPH-P450 reductase [Priestia megaterium],4RSN_B Chain B, Bifunctional P-450/NADPH-P450 reductase [Priestia megaterium]
6N6Q_A	2.79e-09	966	1164	286	471	Crystal structure of a Cytochrome P450 (CYP102L1) [Mycobacterium phage Adler],6N6Q_B Crystal structure of a Cytochrome P450 (CYP102L1) [Mycobacterium phage Adler],6N6Q_C Crystal structure of a Cytochrome P450 (CYP102L1) [Mycobacterium phage Adler],6N6Q_D Crystal structure of a Cytochrome P450 (CYP102L1) [Mycobacterium phage Adler]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NKA3|ABFA_ASPFN	6.98e-246	21	574	23	570	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2
sp|Q2U790|ABFA_ASPOR	1.57e-244	21	574	23	570	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
sp|Q0CTV2|ABFA_ASPTN	8.56e-244	21	574	23	569	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
sp|P42254|ABFA_ASPNG	4.34e-241	24	574	26	569	Alpha-L-arabinofuranosidase A OS=Aspergillus niger OX=5061 GN=abfA PE=1 SV=1
sp|A2Q7E0|ABFA_ASPNC	8.66e-241	24	574	26	569	Probable alpha-L-arabinofuranosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=abfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999737	CS pos: 23-24. Pr: 0.9569

TMHMM  Annotations     

Start	End
619	638
645	667