CAZyme Information: EKG20847.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG20847.1
• CAZy Family: GT22
• CAZyme Description: Glycoside hydrolase family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207		23897.36	6.2146

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000075:17196-17819(+)

Full Sequence      

MFGALVDYWHYTGDDTYNQWTIEGMIHQIGDNWDYMPANQSKSLGNDDQGFWGMAAMSAA
ETGFPNPPDDKPGWLALAQAVFNTQYRRWDSSTCGGGLRWQIYSFNRGYDYKNTITAGCF
FNIASRLTRYTGNSTYAEWADKTWDWMDTLGLINSEYHFYDGSDSKINCSAFDRTQWTYN
AGIFLHGAATMWNIVSHKRRPRMHSQR

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	1	196	6.7e-65	0.505586592178771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.22e-103	1	194	41	234	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.36e-04	95	185	133	215	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS70153.1|GH76	1.64e-101	1	194	74	267
CBX93371.1|GH76	1.18e-100	1	196	47	242
QSZ36627.1|GH76	2.68e-99	1	196	74	269
UJO10931.1|GH76	1.08e-98	1	193	68	260
APA11655.1|GH76	1.52e-98	1	196	73	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	7.79e-81	1	199	82	282	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	3.46e-79	3	194	70	263	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.50e-75	3	194	73	266	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	7.02e-74	3	193	73	267	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	6.95e-72	12	196	80	264	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q05031|DFG5_YEAST	1.02e-68	2	196	77	273	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000030

TMHMM  Annotations     

There is no transmembrane helices in EKG20847.1.