CAZyme Information: EKG19810.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG19810.1
• CAZy Family: GH92
• CAZyme Description: Neuraminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	AHHD01000108|CGC1	38407.16	4.0827

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000108:56340-57440(-)

Full Sequence      

MMAGGLQPWLRSLAVLTLAAGLDATPLHRRAGVVPSLSGDAAIMGPVGNSTYPRANFLSD
GSIIGAFTAFDDNPSTGARESTITLARSADSGTSWTTIGTAARGPTATTDIDNPYVLQLP
SGRLLVAYRNHDRVSADAWSYYRLTVSYSDSNGVDWEYLSTPAQDSDAVTGDWEPFLRMA
DDGTTLQLYYSRENSDADQDSLLRTSSDGGVTWSDPTTIGGAELTTARDGMLGVAKTAAG
DLIAVFETETGGGSFHIEAVTSKDDGATWEDRRVVYQPDDSAKGAAAPQVANVGGTLVVS
FQTNEDGGDYAGKLVTSGDDGQTWDNKITFMPALGQWAGLLALDDSSFLAMAANDGTAKA
QKVVLS

Enzyme Prediction     

No EC number prediction in EKG19810.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	49	307	2.5e-57	0.8664495114006515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.61e-14	58	330	22	299	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.25e-11	114	324	17	237	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.94e-10	180	366	22	230	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.99e-09	63	282	93	306	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	5.57e-07	81	274	80	256	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18927.1|GH93	5.42e-133	1	365	1	355
QKX54349.1|GH93	1.04e-114	12	366	11	363
QKX63957.1|GH93	1.90e-110	6	366	6	365
VDB90996.1|GH93	2.05e-80	11	366	7	368
UQC86738.1|GH93	4.87e-71	13	356	12	351

PDB Hits     

EKG19810.1 has no PDB hit.

Swiss-Prot Hits     

EKG19810.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.032391	0.967569	CS pos: 24-25. Pr: 0.7724

TMHMM  Annotations     

There is no transmembrane helices in EKG19810.1.