CAZyme Information: EKG19759.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG19759.1
• CAZy Family: GH92
• CAZyme Description: Cellulose-binding domain fungal

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	AHHD01000109|CGC1	30499.13	4.3959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000109:364-1310(-)

Full Sequence      

MSGCDLIWLDHVKISLIGRQFLVTGYESAGRVTISNCELDGQTSWSASCNNEHYWTALFL
GDGDQITLANNYIHDTSGRSPKVGESSTIHAVNNYFETNKGHNFDIEQGAQILLEGNVFQ
DCKTPMSEAALAVTSGLFNTPTSSDAAKCSSALGRECQLNTLTDSGDFGSFTDTTVVTAI
GKADSIWEAMAADEVAAYVKAHAGVGKLESSSSSTSSSSSTTSAAAVKAAEETTSASTAS
ATTSSKAPASTSSAAATESTGASSSGATVARWGQCGGKSYTGSTTCADGATCTVQND

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	1	121	2.9e-53	0.6524064171122995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.70e-18	1	123	65	190	Amb_all domain.
395595	CBM_1	1.86e-11	271	297	1	27	Fungal cellulose binding domain.
226384	PelB	2.12e-08	7	208	156	344	Pectate lyase [Carbohydrate transport and metabolism].
197593	fCBD	3.46e-07	270	297	1	28	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
366158	Pec_lyase_C	4.97e-07	7	119	90	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40699.1|PL1_4	1.44e-65	1	210	179	384
QMW28629.1|PL1_4	1.44e-65	1	210	179	384
UDD56677.1|PL1_4	1.44e-65	1	210	179	384
ATZ48538.1|PL1_4	2.89e-64	1	208	173	385
CCD51274.1|PL1_4	2.89e-64	1	208	173	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	7.45e-42	1	208	158	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	2.16e-40	1	208	158	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	1.63e-39	1	207	158	359	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	2.55e-66	1	210	179	384	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	2.55e-66	1	210	179	384	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	3.01e-63	1	208	178	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	1.12e-58	1	211	174	381	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	4.98e-55	1	208	180	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000004

TMHMM  Annotations     

There is no transmembrane helices in EKG19759.1.