CAZyme Information: EKG19563.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG19563.1
• CAZy Family: GH79
• CAZyme Description: Glycoside hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	AHHD01000163|CGC2	32806.65	4.4909

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000163:967196-968268(-)

Full Sequence      

MRLSTLLPAAALAIAPAAASGTLGFSLGTKLADGSCKYQADYEKDFDAISKATGSKLVRG
YSASDCNCAKEILPAAKAKGFQVVLAVWPDVDESLEADKKALKTYATDEYADQIYAVTVG
SETLYRGNFTGEELLDKINDVRTVLPKGCKVGTADSWNKWADGTGDAVVKGGVDLILANA
FAYWQGQDIKNASATYFEDMARAIEHIQDVAGGPEKAPEIWNGETGWPTDGGSDYEDAKA
GTDIAKTYYHEAVCGALKWGVNAFYFEAFDEPWKPHAIGDSGAAGDETKWGAMTADRQVK
FDLKCK

Enzyme Prediction     

No EC number prediction in EKG19563.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	305	5.8e-34	0.9967845659163987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.22e-65	20	297	43	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.24e-34	23	305	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR43216.1|GH17	2.56e-145	9	305	8	305
SMY20536.1|GH17	2.56e-145	9	305	8	305
SMR45377.1|GH17	1.48e-144	11	305	10	305
SMQ46852.1|GH17	1.48e-144	11	305	10	305
QIX02470.1|GH17	5.05e-139	1	305	1	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.97e-33	33	300	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.95e-32	33	300	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	4.62e-117	1	306	1	302	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	5.49e-76	1	305	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	3.58e-73	16	305	35	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|Q5AMT2|BGL2_CANAL	3.54e-67	18	306	17	306	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	7.08e-67	18	306	17	306	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000345	0.999633	CS pos: 19-20. Pr: 0.9612

TMHMM  Annotations     

There is no transmembrane helices in EKG19563.1.