CAZyme Information: EKG19016.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG19016.1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	AHHD01000167|CGC2	42257.64	6.2817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000167:152338-153575(+)

Full Sequence      

MEPRFQRLVAVLIFFAVCLSLWLHSPSLHHREQASAKQAAPPFTHGLNYTRLHPANSTLG
FGAVLAVSRENSPRQEALYFASNLTGLDITVPHQPHWSEDDLNELKADSGSRITRGSALA
WLGHLNALKWFMKSGLETALILEDDVDWDIHLRSTQVPLASENLRALLDSDQTYWSDLRK
WEILYLGHCGDFFDADKLDGLPHRVYRDDTLLPHRRMHPHTKEFLDKLGLEEGQRMIHRS
KWPLCTFGYAVTRASAHRILSELAAKESEGGCEAFDVRILEACRDLDYQCYSANPELFHH
ISAPSEIANINEGIDSTGRLQSQKSVGGTTNIACGARSESFFTKDPATLQYLQKEVGEKG
HCLMDPLEQASDRPF

Enzyme Prediction     

No EC number prediction in EKG19016.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	99	263	8.2e-16	0.7016574585635359

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	6.46e-05	74	151	13	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS68839.1|GT25	8.40e-109	1	372	1	391
QRD04770.1|GT25	1.48e-86	54	369	48	427
UNI13393.1|GT25	6.87e-85	55	363	54	387
CAE7032731.1|GT25	9.02e-85	1	365	2	420
CAE7186744.1|GT25	8.31e-79	3	369	2	374

PDB Hits     

EKG19016.1 has no PDB hit.

Swiss-Prot Hits     

EKG19016.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.978328	0.021703

TMHMM  Annotations     

Start	End
7	24