CAZyme Information: EKG18628.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG18628.1
• CAZy Family: GH63
• CAZyme Description: peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		57171.90	4.8494

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000183:39860-41571(+)

Full Sequence      

MRFLGGFYLLLAATRHTPTARAALHYPNALISRMEHLLVDTDGSFRSGFKDAINPCTNYI
SGAQTLGRQTSAQWLRVAFHDFVTAHVDEGTGGIDASIGFETLRAEDSGSAFNDSFAFFA
PFVDAQTSMADLVALSVVTSLGHCGGLHVPYRAGRIDATGGGPFGVPEPETSLEETLEEF
ANAGFNAEDAIGLTACGHSLGRVHHGGFPNVVPESAIAPNNTAGGVNLDSTRDKFDISIV
KEYLGNYGQRGGPLVTSDNVTVRSDLRLYESDQNRTMQALGQSKEYFFSTCGNLFERMIN
TVPREVTLSDVIHPMTVQPVNFTFDIINDQALRLSGVVRYLPSDNAAPSTLEVSLADKAG
KTMASITARVIEEKGNSFWGATAYYPVVFDINLAGIASRNNLPGKLQVRTASPQTFELQP
ELFFIPSRSSPGTGISVGAAIGAAARSRNSTLSVESVEAVVSVPVSQTGTLAPKVEKHEL
NLERDQDIGLYSIFKGNLSDDLAFNLQTTVDITATFSDGTVWQDSYNRFAVP

Enzyme Prediction     

No EC number prediction in EKG18628.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	69	244	2.8e-22	0.6509803921568628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173829	plant_peroxidase_like_1	5.50e-87	31	300	5	264	Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions.
173823	plant_peroxidase_like	5.69e-21	72	300	19	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	8.28e-14	60	204	5	155	Peroxidase.
173825	ascorbate_peroxidase	1.57e-08	75	204	34	168	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178467	PLN02879	6.11e-08	49	222	13	189	L-ascorbate peroxidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW22025.1|AA2	1.97e-71	20	528	15	527
UKZ86986.1|AA0	2.05e-70	26	363	26	366
QRV79935.1|AA2	1.03e-69	9	528	5	524
QRV94524.1|AA2	5.80e-68	9	528	5	524
QYT03617.1|AA2	8.49e-67	8	339	9	340

PDB Hits     

EKG18628.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF4|WSCD2_ARTBC	2.64e-54	29	530	25	506	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1
sp|Q8GY91|APX6_ARATH	3.58e-08	58	201	103	247	Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana OX=3702 GN=APX6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000275	0.999691	CS pos: 22-23. Pr: 0.9447

TMHMM  Annotations     

There is no transmembrane helices in EKG18628.1.