CAZyme Information: EKG18378.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG18378.1
• CAZy Family: GH55
• CAZyme Description: Cutinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	AHHD01000208|CGC2	25198.84	6.4458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000208:71935-72793(-)

Full Sequence      

MGGGSSGSDSGSGTSSIGSLGSGLGLTPRQDSGSTGSSGSSGLGALGGLMGGSSGSGVSA
LGGLGGGLGGSTQNGLDEACKPVTLIFARGTTEMGNMGSVVGPGFASALKQQLGEDKVAV
QGVDYAASAGGIATEVTGGAGTQAMVADVQKAVQKCPDTQIVLSGYSQGAMLVHNTANKL
AGDQASKVKAAVTFGDPFKSQALKNVPEGAFKTFCATSDPVCGAGGVGALGGAGASSGGT
SSSSTSGHLGYGTDAGAAATFVKSKVQV

Enzyme Prediction     

No EC number prediction in EKG18378.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	79	265	2.6e-42	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.64e-43	79	266	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99001.1|CE5	4.85e-55	71	262	31	204
QGI75372.1|CE5	1.78e-54	27	267	156	364
QGI89066.1|CE5	1.78e-54	27	267	156	364
QGI58153.1|CE5	1.78e-54	27	267	156	364
CCT61737.1|CE5	1.96e-54	27	267	160	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	8.18e-27	77	262	76	243	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.49e-21	77	222	18	168	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
1CUZ_A	4.18e-21	74	267	25	208	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	5.83e-21	74	267	25	208	Chain A, CUTINASE [Fusarium vanettenii]
3QPD_A	6.27e-21	77	222	9	159	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	1.57e-45	71	264	49	219	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	6.21e-36	79	263	30	197	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.57e-32	79	263	30	196	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q4W9Z4|CUTI3_ASPFU	2.58e-31	80	267	39	216	Probable cutinase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G03210 PE=3 SV=1
sp|B0YEP5|CUTI3_ASPFC	2.58e-31	80	267	39	216	Probable cutinase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_099910 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998363	0.001676

TMHMM  Annotations     

There is no transmembrane helices in EKG18378.1.