CAZyme Information: EKG18375.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG18375.1
• CAZy Family: GH53
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	AHHD01000208|CGC1	66259.93	4.7627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000208:62778-64598(+)

Full Sequence      

MHIPFSLLALAALSTAGTPLRNSENNTYEYIVVGSGPGGGPLAANLAKNGHSVLLLEAGD
QQPDNQNSYMVYNNTPAINDPLTRWDFFVSRDEPEIDQQYQFTTWRQTDGEFYVGLDPPE
GAERLGVYYPRAGTVGGCAMHNAATISLPADVDWQDVADITGDESWAPENMRQYLIRLER
CNYLANGSDPSHGFSGYLDTSQADPSWSLNTSDATTLVQLISDALGGRETGLTVTELLSR
DVNANVPGRDNITGVFTGHTHSRNGVRSSPLNYIRAVLADARNYPLILQENTLVTKVLFS
NTSTKHDQPRAIGVEFLQGKSLYSADPRHDPCTPGIPGRAFATKEVILAGGVFNTPQLLQ
LSGIGAAVELSKHSIPLVHELPGVGTGMHDNYEAVLYGTYAQPVTAFWDIWLKTSHAQRT
RDVHFYCGSMNFVGFFPGMPGWNANEFECGFMQLHPRNMNGTVRLRSADPRDTPAIDLGF
FRNGDDEDLEGMVEAINFVRPLFNNITGNAFTEHRPCGPGVECTDEWQRRFLRAQTYSHH
VSGTCAIGADDDPLAVLDSKFRVRGVRGLRVVDGSAFPVQPGEVPTLATFMISEKALDDI
LADASV

Enzyme Prediction     

No EC number prediction in EKG18375.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	604	5.4e-71	0.511326860841424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.62e-54	42	601	20	532	choline dehydrogenase; Validated
225186	BetA	1.61e-49	42	604	22	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.17e-33	461	596	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	7.19e-17	294	592	243	567	Protein HOTHEAD
366272	GMC_oxred_N	2.09e-13	127	367	19	205	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI67528.1|AA3	0.0	1	603	3	601
UPK92989.1|AA3	2.98e-289	1	602	1	545
QRD01027.1|AA3	1.24e-187	3	603	5	615
QBZ53739.1|AA3	1.89e-186	5	604	62	662
CAP64871.1|AA3	7.84e-180	28	603	28	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.32e-40	20	598	6	524	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.32e-40	20	598	6	524	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	3.36e-40	20	598	6	524	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6F97_A	8.94e-27	28	604	6	531	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	1.20e-26	28	604	6	531	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.73e-39	20	598	6	524	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	1.46e-38	25	603	2	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	4.55e-38	28	601	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	1.33e-36	28	601	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	4.08e-36	5	604	9	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001542	0.998410	CS pos: 16-17. Pr: 0.9121

TMHMM  Annotations     

There is no transmembrane helices in EKG18375.1.