CAZyme Information: EKG18229.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG18229.1
• CAZy Family: GH5
• CAZyme Description: Glycoside hydrolase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	AHHD01000213|CGC1	54703.37	5.2847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000213:7423-9420(-)

Full Sequence      

MAEAVLPKDFLWGFATASYQIEGAPNEDGRADSIWDTFCRKPGKIADASSGDVACDSYHR
TAEDIALLKQCRAKAYRFSLSWSRIIPLGGRNDPVNEKGLQHYVKLADDLIAAGITPMVT
LYHWDLPDELDKRYGGLLNKEEFVADYVHYARVVFKAFGSRVKYWITFNEPWCSSILGYS
TGLFAPGRTSNRSKNPEGDSSREPWIVGHNLLIAHASAVKVYREEFKAKDGGQIGITLNG
DYMYPWDPEDPRDVEAANRKHEFSISWFADPVYFGKYPDSMRKQLGDRLPEFTADEAALI
KGSNDFYGMNHYTANYVKHVDTEPAEDDFLGNLECTFYSKKGECIGPETQSPWLRPNGLG
FRKLLKWISDRYGRPTIYVTENGTSLKGENDLPLEQLLEDDFRVKYFDDYIHALADAYSK
DNVDVRGYMAWSLMDNFEWAEGYETRFGVCYVDYKGGQKRYPKKSARAIGEIFDALMRKD

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	473	2.7e-164	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	4	467	3	442	Glycosyl hydrolase family 1.
274539	BGL	1.03e-171	7	467	1	424	beta-galactosidase.
225343	BglB	6.75e-143	6	467	4	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	5.10e-123	7	466	31	473	beta-glucosidase
215435	PLN02814	5.35e-116	6	466	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7220638.1|GH1	9.60e-295	1	480	1	480
QRD02870.1|GH1	3.55e-290	1	480	1	480
QRD82378.1|GH1	6.27e-287	4	479	7	482
QMW27934.1|GH1	6.27e-287	4	479	7	482
UDD55888.1|GH1	6.27e-287	4	479	7	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.02e-283	1	480	21	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.60e-243	5	480	2	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.87e-240	5	480	2	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	5.73e-240	5	480	21	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	6.10e-239	5	477	8	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	3.41e-201	6	475	11	473	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.34e-187	1	473	1	456	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q7XKV4|BGL12_ORYSJ	7.88e-147	7	466	40	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|Q8L7J2|BGL06_ORYSJ	2.26e-146	7	478	51	520	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|B8AVF0|BGL12_ORYSI	4.48e-146	7	466	40	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EKG18229.1.