CAZyme Information: EKG18183.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG18183.1
• CAZy Family: GH5
• CAZyme Description: Pectate lyase catalytic

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	AHHD01000215|CGC2	25089.03	7.4138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000215:133584-134450(-)

Full Sequence      

MKFIYAAITATVAGLASAQSLTIPTRSGSKVVLSAPSTISGSQDFGNKEFDRGIPCDSDD
DTGSSSAVFILKNGASISNVIIGTDALEGVHCEGACTLTNVWFRDVCEDAISALGTGNVL
IQGGGAQNAKDKVVQHNGRGTVTIKNYTVVNAGKLYRSCGDCTNNGGPRNVVVDNVRVNG
MTSDLVGINSNYGDTATISNSCGVSKKVCQEYKGVTKGNGDSEKVSTTANCKGAQGTLSK
LPTC

Enzyme Prediction     

No EC number prediction in EKG18183.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	214	9.4e-72	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	2.92e-85	20	219	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO24501.1|PL3_2	6.83e-132	11	244	8	241
CAE7219057.1|PL3_2	1.73e-123	6	244	5	245
UQC87820.1|PL3_2	3.91e-119	8	233	7	232
CBX97807.1|PL3_2	7.78e-109	10	244	9	246
CEI67773.1|PL3_2	5.08e-106	1	239	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	1.71e-39	53	241	22	226	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	2.89e-38	53	241	140	344	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4U49_A	3.06e-31	53	241	143	347	Chain A, Pectate lyase [Pectobacterium carotovorum],4U49_B Chain B, Pectate lyase [Pectobacterium carotovorum],4U4B_A Chain A, Pectate lyase [Pectobacterium carotovorum]
1EE6_A	4.31e-23	68	176	43	145	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.82e-18	68	163	46	141	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7Z3|PLYE_EMENI	9.40e-60	20	232	33	246	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|A1DBJ7|PLYE_NEOFI	5.33e-59	20	224	33	236	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q4WC29|PLYE_ASPFU	8.56e-58	20	227	33	239	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	8.56e-58	20	227	33	239	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	1.30e-56	23	227	42	249	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999713	CS pos: 18-19. Pr: 0.9700

TMHMM  Annotations     

There is no transmembrane helices in EKG18183.1.