CAZyme Information: EKG18070.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG18070.1
• CAZy Family: GH5
• CAZyme Description: Glycoside hydrolase family 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		35084.55	6.8591

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000218:274298-275407(+)

Full Sequence      

MRLSTLLIAGSASLALAAPVQKEEKRASNFQFFGVNESGPEFGETKLPGTKNTDYVWPTL
STIDTFVGKGMNTFRVNILMERLTHNSLTASLDSQYLADLKTTVNYITGKGAYAMIVPHN
YGRFNSQIITDTAGFKTWWTNVAKEFAGNSKVIFDINNEFHDMDQTLVVNLNQAGIDGIR
AAGATSQYITAEGNSWTGAWTWTTSENGKTMAALKDPQNKLIYQMHQYLDSDGSGTNEAC
VSSTIGKERITAATKWLKDNGKKGLIGEFAGGNNSQCKTAVEGMLTYMQENKDVWTGALC
MEPKTGTAYTAYLDLISKFK

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	32	299	3.7e-103	0.9539007092198581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.23e-71	35	297	1	265	Cellulase (glycosyl hydrolase family 5).
225344	BglC	4.46e-14	28	297	43	353	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAB51451.1|GH5_5|3.2.1.4	8.25e-232	1	320	1	333
CAE7192858.1|GH5_5	3.11e-134	8	319	9	331
ACE10214.1|GH5_5|3.2.1.4	3.33e-134	1	319	1	334
CAZ67882.1|GH5_5|3.2.1.4	3.33e-134	1	319	1	334
CAT02251.1|GH5_5|3.2.1.4	3.33e-134	1	319	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GZJ_A	8.14e-131	30	319	3	303	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	1.38e-129	27	319	1	304	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]
5I77_A	4.88e-122	30	319	2	301	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	4.26e-121	30	319	4	303	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	4.41e-121	30	319	5	304	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DME8|EGLB_NEOFI	3.20e-133	4	319	5	327	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|Q2UPQ4|EGLB_ASPOR	6.96e-131	1	319	1	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
sp|B8MW97|EGLB_ASPFN	6.96e-131	1	319	1	331	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	2.09e-127	4	319	5	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|O74706|EGLB_ASPNG	6.64e-126	4	319	5	330	Endo-beta-1,4-glucanase B OS=Aspergillus niger OX=5061 GN=eglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999676	CS pos: 26-27. Pr: 0.8955

TMHMM  Annotations     

There is no transmembrane helices in EKG18070.1.