CAZyme Information: EKG17977.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG17977.1
• CAZy Family: GH5
• CAZyme Description: GH131_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:K2RZ35]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157	AHHD01000219|CGC1	17363.19	4.3952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000219:38323-38856(+)

Full Sequence      

MRCETADPLIVLLFFSPQNVWHEAADYSANQFNFNTGYRIGTNGTDKESWQLLGRDSNLL
WSTPIDFENWQNFALTLDYTANTLTVYTSKNAEPLKKAGGPFKNDNSGAGQFQIGILKKP
TGTDDVVNSGFQESGFKEGQIYGGIFVENSANNCVSL

Enzyme Prediction     

No EC number prediction in EKG17977.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	18	152	2.3e-41	0.5215686274509804

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.59e-47	18	151	116	249	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59804.1|GH131	2.52e-54	19	157	191	330
UPK91234.1|GH131	8.84e-52	19	156	206	342
QKD55659.1|GH131	9.82e-52	19	157	157	294
UQC86340.1|GH131	4.74e-51	19	157	162	301
QGI96469.1|GH131	1.57e-50	19	157	157	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W9A_A	4.48e-06	38	118	128	205	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

EKG17977.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.759541	0.240475

TMHMM  Annotations     

There is no transmembrane helices in EKG17977.1.