CAZyme Information: EKG17027.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG17027.1
• CAZy Family: GH35
• CAZyme Description: Lipopolysaccharide-modifying protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
950	AHHD01000257|CGC1	105984.30	7.5209

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000257:61406-64706(+)

Full Sequence      

MQLALSPHVAHLQSLSARSPTVLAAAFIASSAVSALAASQEHSLLVAAVSWALLWTYSSA
RVGLWTGWDNVLRRRYSWTAGALLALAAVCEQAAHDPEGIWWTKALLPATLCALRTADVV
GRTSPFIVLEDPQGPDSARHDISNGLLAVLTVAGAGGLSVATILPQVLALALSSMLLTSI
ALLVLEHAITAIRDYKQSMSNGPSPIIPMRPRSNTVIRSDAWLVSLRDTSAVVAPACLVL
AFVFERSFRTDTIYHGVNGDEAVGVWEHAGRLWALQRGLQAAFTGALKHLTLFSMIRQAG
AFPAACASVASLLVARSYTIPSFTSYWFTLLYSGAGVLSLSDSCTGNKMIARHFLTSISV
VSFILLTIGYLRQSASSFNAFYGSTPSDHAFQFESPVDPLKPLALPSLDKHPIEQLVKGA
ETRFEDMLSRQSQNLGDAVAEYRRRYGVPPPPNFDRWFEFAKRKGVQLIDDGYDSIYHSL
LPFWALEPATIRARVREALGHGENALIGLLIRDGQATHVEGGQNWQKEATLGMIKNFLAY
LPDMDLAFNIHDEPRVVVPNDELSRLVERAKTVRMPVAFANQQPKNQFSKRPKDMNNGKR
IDEVKTTRFNRFAHQGTWTHSRLSCPPDSPARSIDEHPSDNLTAYAVGELGFIYNASAFS
DICNSPSLSHSYGFFDRPNAFNLVQELFPIFSQSKISSYQDILYPSPWYWYGKVPYDGER
DLPWEDKQDSLYWRGSTTGGFSRNGGWRRQHRQHVVSRLNEPGKALIMAKRDDGNAAVWG
PKTVSRKDYAELMDIHFSHIGQCDPGDCDAQREYFKLAPAADQQDAWAHKHLLDMDGNAF
SGRFYAFLQSKSLVYKMAIFREWHQDWLQPWLHYVPLSLRGDEWLETIRFFSSEDGSDGK
KTAKKLADEGRKWASKALRNEDFEAWFFRLLLEYGRLIDDNRDTIGYPGP

Enzyme Prediction     

No EC number prediction in EKG17027.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	666	938	9.3e-83	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.03e-25	689	937	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.65e-11	689	937	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74092.1|GT90	3.37e-316	20	950	17	950
UJO10778.1|GT90	3.21e-295	39	949	38	958
SMR42421.1|GT90	6.73e-279	42	949	45	960
CAE7014360.1|GT90	1.14e-278	41	950	32	977
SMQ46076.1|GT90	3.82e-278	42	949	45	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	3.20e-10	689	950	154	394	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	7.44e-08	676	941	105	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.46e-49	411	944	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	7.38e-11	681	938	156	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.65e-09	685	938	159	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.71e-09	689	950	166	406	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.57e-08	775	937	303	466	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.776574	0.223410

TMHMM  Annotations     

Start	End
21	38
43	65
142	164
168	190
293	315
319	341
354	371