CAZyme Information: EKG16660.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG16660.1
• CAZy Family: GH31
• CAZyme Description: Six-hairpin glycosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		46983.75	5.0697

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000265:78202-79509(+)

Full Sequence      

MKSFLLAAAAVASATLASAKITLPNGWFKIPPDQKIKAAKFDGKPRYLTWMADSQIKHGV
EPTFAYTVSAYLSGIKLAYDRTGDEKYYDYLKRHTDIVLYPAWNGEILLYNNSNSIDDIR
FGHTFLDLYNLTGGEEIYRKAAQTLRNQIDRTGRTPDGGFYHRYPVYIDQMWLDGIYMLD
VFYARWTHEFEPENATAWDDVARQFDLIDAGTTVDRERTGGLPLHGFDYSKSTVWADPET
GAAPHVWGRAVGWYIMALVDTLDYFPETHPGRERLVGYLRSLADAIVAAQDERTKGWYNI
MDPGLEERSGNYIESSGSAMFVYGLLKSLRNGYIQGEKYLKAALGGYKLMTETFAEERKS
DGSLAWGWTVQTGSLSSNGTFEYYASIPLYENDLKGVSPFLFASYEYELYVEGGK

Enzyme Prediction     

No EC number prediction in EKG16660.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	408	2e-93	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	1.06e-68	51	408	5	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	8.91e-67	47	409	15	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY01014.1|GH105	1.46e-254	1	412	1	413
UQC75320.1|GH105	2.58e-231	22	415	22	413
CEI59966.1|GH105	8.41e-225	1	410	1	407
QKD61168.1|GH105	5.22e-224	1	410	1	407
QGI86988.1|GH105	2.46e-222	1	410	1	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.78e-72	46	408	3	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.77e-51	66	415	41	373	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.01e-50	66	415	31	363	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	4.04e-12	149	406	178	409	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5NOA_A	7.53e-09	69	351	59	325	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.45e-50	66	415	41	373	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	5.36e-26	199	403	20	224	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	5.36e-26	199	403	20	224	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999702	CS pos: 19-20. Pr: 0.9495

TMHMM  Annotations     

There is no transmembrane helices in EKG16660.1.