CAZyme Information: EKG16430.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG16430.1
• CAZy Family: GH3
• CAZyme Description: Six-hairpin glycosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		66941.05	4.5001

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000269:145953-147791(+)

Full Sequence      

MAFLASAVSAQAAPPAQEEAGVLAYPFDISQVRLSDGRWQENQERTRTYLKFVDLDRLLY
NYRATHGLSTNGAASNGGWDAPDFPFRSHAQGHFLTAWVQCWSTTGDTECRDRAVQFTAE
LLKCQENNEAAGFTAGYLSGFPESEFDALEGRTLSNGNVPYYVVHKLMAGLLDVWRGIGD
LTARDVLLALAGWVDARTENISYGDMQRILQTEFGGMSEVLADIYYQSGDSRWLTVAQRF
EHAAVLTPLANNRDQLNGLHANTQVPKWIGAAREYKATGNTTYYDIARNAWDITVRAHTY
AIGGNSQAEHFRPPNAIAGYLTADTAESCNSYNMLKLTRELWTTEPSSSAYFDYYERTLM
NHLVGQQDPEDPHGHVTYFNSLQPGGVRGVGPAWGGGTWSTDYDSFWCCQGTGVETNTKL
MDSIYFRDGDSSALYVNLFAPSVLDWRQRAVTVTQTTSFPVTDNTTLQVAGAAGAWDMAI
RIPDWTSGAEILVNGESANVAAEPGTYATISRDWASGDTVTVTLPMGFRLVPANDDTSIA
ALAYGPVILCGNYGTATPESNPTLALSSVKRTSGSSLDFEASADGATVRLGPYYDAQGFN
YVTYWKTDGVLP

Enzyme Prediction     

No EC number prediction in EKG16430.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	31	549	5.3e-192	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	2.50e-164	31	550	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	1.33e-105	32	554	12	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCB89999.1|CBM13|GH146	3.25e-311	4	607	17	621
BCJ47901.1|CBM13|GH146	3.49e-310	10	609	32	623
AZP22590.1|CBM13|GH146	5.72e-310	4	609	26	631
QLD25855.1|CBM13|GH146	5.83e-307	7	609	33	634
ASW55346.1|CBM13|GH146	6.38e-306	5	609	31	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.80e-89	27	555	28	565	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.15e-84	27	555	28	565	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QJY_A	1.44e-12	157	550	183	560	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	7.99e-12	161	550	192	607	Glycoside hydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	2.30e-11	157	550	183	560	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

EKG16430.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.648408	0.351578

TMHMM  Annotations     

There is no transmembrane helices in EKG16430.1.