CAZyme Information: EKG16162.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG16162.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		38946.68	6.7225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000284:55446-56512(+)

Full Sequence      

MRKGVLIFLIINLIVIGVLVRNVWTLLELLVVDGSEDRISRAELPAPNSGAISERPQLIP
KIIHQTYINESIPPVWQEAQKSCIDLHEDYEYKLWTDKKAREFIAAEYPWFLETFDGYEF
PIQRADSIRYFVLAHFGGVYIDLDDGCNRRLDPLLAYPAWLRRTVPTGVSNDAMGAVPRH
PFFLKVIDALPRYNRNWLLPYITVMGSTGPLFLSVIWRHYNNEGPAEDGRIRILFGDEYN
NHPWSFFTHHLGNSWHGGDVKLIFWMARHWFLLTVLGFVIGFSVIGGLWWTYRCMAQKSR
RGGLARLLPFPGSGRSGDVEYELVGRNDEDEEDRHKV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	1.3e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.20e-76	1	282	10	307	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.79e-24	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY00993.1|GT32	1.83e-169	1	289	1	289
CAE7009206.1|GT32	8.40e-167	1	337	1	332
QRD00626.1|GT32	1.35e-164	1	337	1	337
QDS70160.1|GT32	2.09e-163	2	330	3	340
CAK42232.1|GT32	5.36e-160	1	292	1	292

PDB Hits     

EKG16162.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.50e-103	1	294	1	300	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.91e-102	1	299	1	295	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	9.54e-85	48	310	46	310	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.47e-82	58	282	81	308	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	6.47e-54	59	305	64	308	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.700737	0.299264

TMHMM  Annotations     

Start	End
5	24
270	292