CAZyme Information: EKG15736.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG15736.1
• CAZy Family: GH27
• CAZyme Description: Glycoside hydrolase family 47

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	AHHD01000293|CGC5	64545.19	6.5088

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000293:486540-488261(+)

Full Sequence      

MASLKRCQRNPTPVFKLLSAILIITFYGIYLLIHGSPLASTLEADSNTPRGPQIQHQPWT
GASGRADEEKAARIVEAMKYTFAKYRKHAWGYDDILPVSGGKKNTRNGWGAFIVDSAGTL
ALMGLWDELQASVERIIDIPFYDAQGLVDPFETTIRYVGGLVSLVDLIDAGVVPKSVIDG
KTRAAILSQAIVLSDKLGPGFDSPTGMIYPRVDFKNNIGTADPPELYEEYPDKIRYKNPS
IGPARAGSNMLEYRTLTRQSGNPIYFSNATNAWAPLVWDRWIEDPVGLVSAPIDIFTGEP
VGRQRHWDVGHDSYYEYLIKAAILAPHDRYTSTYIDRWTQAAHALRHDLSTRSSYASHYT
PSHLFIGKLDDEWYLNEMSHLACFAPGNLMLGGAYLEKPDLIVLGKALIEGCRHTYASMP
TGIGPEKFSWVPYAGLPNGTFEPRTPRQRAELAERGFWLADAKYRLRPEYVESLFYAWRI
TGEQRYRDWAWDAFVAFEKYCKTEYGFAAIRDVGVDVNRGKKVTHIDEAESFWAAETLKY
LYLTFADVNVGTLDAWVFSTEGHPFRIIRTTEN

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	78	567	6.6e-113	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	7.78e-156	77	567	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.11e-102	34	567	30	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS69807.1|GH47	5.11e-221	8	566	26	642
CAE7174864.1|GH47	1.39e-214	8	569	13	569
QRD07001.1|GH47	2.61e-214	8	569	13	567
CBX90682.1|GH47	7.98e-214	8	569	13	569
EGX51673.1|GH47	4.59e-137	49	573	39	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.12e-82	66	569	1	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.50e-82	65	569	35	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1.21e-60	64	567	9	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	8.36e-55	69	569	21	469	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.02e-54	69	569	19	467	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2ULB2|MNS1B_ASPOR	6.04e-85	62	567	32	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	6.04e-85	62	567	32	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|A1CP08|MNS1B_ASPCL	6.21e-85	70	567	35	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	4.39e-84	68	567	37	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	7.70e-82	65	569	35	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

Start	End
13	35