CAZyme Information: EKG14912.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14912.1
• CAZy Family: GH16
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		28456.96	4.3691

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000334:26315-27097(+)

Full Sequence      

MDQINNGISYATSNNRTYEGLANYVSYPNVTDIYGVEAAADLASSVRNALPTWAAEIAAQ
NNNATDASTLLGLLEVQYSLLFESQVPIAEILHIPAQHFGSEYWGTLPFARGNIHITSPD
PNTPTAINPNYFMFDFDLDVQVGVAKFFRKLFATGELAELAGEELQPGVATVSQTASDEV
WADWVKASWRPNFHVLSTAIMMPREMGGVVSERLKVYGTRNVRVVDGSVLPFQVCGHLTS
TIYAIAERASDLIKEDAGIY

Enzyme Prediction     

No EC number prediction in EKG14912.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	256	4.1e-53	0.45774647887323944

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398739	GMC_oxred_C	5.87e-39	108	249	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	2.88e-25	108	258	392	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.27e-18	98	254	385	532	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA16355.1|AA3_2	1.53e-88	2	256	332	588
ATZ57408.1|AA3_2	9.15e-84	2	256	333	589
BAV03498.1|AA3_2	2.30e-80	23	258	365	601
BAV03496.1|AA3_2	2.30e-80	23	258	365	601
BAV89805.1|AA3_2	2.00e-79	25	258	357	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.24e-80	2	257	315	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	6.87e-42	20	254	347	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
1GPE_A	5.99e-34	25	256	353	582	Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense],1GPE_B Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense]
5NIT_A	3.18e-28	50	256	371	576	Glucose oxidase mutant A2 [Aspergillus niger]
5NIW_A	8.08e-28	50	256	371	576	Glucose oxydase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P81156|GOX_PENAG	3.08e-33	25	256	353	582	Glucose oxidase OS=Penicillium amagasakiense OX=63559 PE=1 SV=1
sp|Q92452|GOX_TALFL	1.21e-32	25	256	371	600	Glucose oxidase OS=Talaromyces flavus OX=5095 GN=GOX PE=3 SV=1
sp|P13006|GOX_ASPNG	1.13e-26	50	256	395	600	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.59e-26	81	253	446	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.59e-26	81	253	446	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000004

TMHMM  Annotations     

There is no transmembrane helices in EKG14912.1.