CAZyme Information: EKG14911.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14911.1
• CAZy Family: GH16
• CAZyme Description: Glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		33484.34	4.7507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000334:25210-26206(+)

Full Sequence      

MRSLRLIPILSSLAATSPLKSTDIPNTFDYIIAGGGAGGLVVANRLSETNASVLIIEAGG
PGYDNPNVTAPDGYGRALNTAIDWSYPTVPQKDGSVHAMHAGKVLGGSTAINGMSFTRAE
ASQIDAWEKVGNKGWNWENLWQYYLKSESYQVPGPEQVRGGAAYDASFHGDEGNLKVGYP
KSQAIDNFLAPLNASYQELGIPYSQDVSGGTMRGFNVFPMMIDVEENIRSDAARAYYFPF
QSRSNLAVIYETSVHRIIWTDDDKDGNAVAVGVEAGSANGTTLTFHANKEVIIAAGALRS
PAILELSGIGNRE

Enzyme Prediction     

No EC number prediction in EKG14911.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	27	313	1e-92	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.04e-45	41	313	19	276	choline dehydrogenase; Validated
225186	BetA	1.24e-40	21	310	1	277	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	3.67e-30	92	313	14	206	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.52e-13	4	312	29	303	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL52567.1|AA3_2	1.16e-100	12	311	12	312
QMW26415.1|AA3_2	3.34e-100	12	311	12	313
QRD87483.1|AA3_2	3.34e-100	12	311	12	313
QMW38494.1|AA3_2	3.34e-100	12	311	12	313
UCK58974.1|AA3_2	3.34e-100	12	311	12	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.13e-99	27	311	5	291	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
1GPE_A	3.44e-53	27	313	24	311	Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense],1GPE_B Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense]
1CF3_A	6.39e-52	27	313	19	307	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
5NIT_A	3.24e-51	27	313	17	305	Glucose oxidase mutant A2 [Aspergillus niger]
5NIW_A	6.28e-51	27	313	17	305	Glucose oxydase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P81156|GOX_PENAG	1.77e-52	27	313	24	311	Glucose oxidase OS=Penicillium amagasakiense OX=63559 PE=1 SV=1
sp|P13006|GOX_ASPNG	3.27e-51	1	313	1	329	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1
sp|Q92452|GOX_TALFL	8.80e-51	27	313	42	329	Glucose oxidase OS=Talaromyces flavus OX=5095 GN=GOX PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	4.74e-43	27	313	46	338	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	4.74e-43	27	313	46	338	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.896475	0.103548

TMHMM  Annotations     

There is no transmembrane helices in EKG14911.1.