CAZyme Information: EKG14851.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14851.1
• CAZy Family: GH16
• CAZyme Description: Galactose-binding domain-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	AHHD01000336|CGC1	36684.46	4.2556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000336:88196-89218(-)

Full Sequence      

MIHGTHFQASSSDAFAPGKTWGPWLWYLNDGSQSDAAARAAQEFAAWPYAWFENAWYQAR
APKVVGRVVLSDGRPASGAAVFLGDDAPNKTALDMGSNYYYTTYADEDGAFEFVDVLAGT
YGLQAWADGGALADVSTSLLQNGVVVSAAASAAARKRDAAALDLGEFEWQLHEGRQRVFQ
VGDFDRKSTGFRFSGEPQYHHGLVSECPAGLTFTVGESADEDWCFGQSALGAWDIAFEVD
EVQAGRSAILTVSLAGYSQGTSAVILVNGETQVGNLTSGRIPSDPCLYRSATVAGEWHLF
EFEFDGGSVLKEGKNTVTFNVTASTLWRGFLWDSIILEWA

Enzyme Prediction     

No EC number prediction in EKG14851.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	1	325	2.1e-122	0.603082851637765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405384	CBM-like	5.27e-50	177	337	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	3.65e-40	179	338	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	4.18e-12	64	130	5	70	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
404503	CarboxypepD_reg	8.67e-09	64	146	2	75	Carboxypeptidase regulatory-like domain.
405387	fn3_3	2.03e-06	97	131	23	57	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65538.1|PL4_5	3.06e-136	1	339	246	574
BCS19874.1|PL4_5	2.66e-123	1	339	247	572
CBY02118.1|PL4_5	4.33e-116	1	338	244	569
UQC83548.1|PL4_5	2.45e-114	1	335	361	703
QRC94889.1|PL4_5	4.43e-110	1	339	243	570

PDB Hits     

EKG14851.1 has no PDB hit.

Swiss-Prot Hits     

EKG14851.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.991498	0.008523

TMHMM  Annotations     

There is no transmembrane helices in EKG14851.1.