CAZyme Information: EKG14749.1

Basic Information

• Species: Macrophomina phaseolina
• Lineage: Ascomycota; Dothideomycetes; ; Botryosphaeriaceae; Macrophomina; Macrophomina phaseolina
• CAZyme ID: EKG14749.1
• CAZy Family: GH16
• CAZyme Description: Fungal chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230	AHHD01000337|CGC1	23978.51	4.7985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MphaseolinaMS6	14712	1126212	906	13806

• Gene Location: location=AHHD01000337:116391-117387(-)

Full Sequence      

MFSAATAYDVPANLQKIYDAHKPGKCAQKLLGGFAPGVGSSDHTFAYCRDISANTIFLHS
SAAGGQYADMDVDCDGANLGAGDCANDPTGQSQTAFQDQVRAHGIADLDANVHPYVVFGN
DSPRFDPQEYGMRPLSVVAVVCGGKLHYGIWGDTNGADTVGEASIALAKLCFPNDGITGD
NGHDQKDVLYIGFTGSGAVPRNANWKAGSARDFETSIRALGDKLVAGLSA

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	3	226	1.2e-81	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	2.23e-94	70	226	1	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	2.05e-104	5	230	16	242
QRD91118.1|GH75	4.38e-101	1	230	11	241
QMW46870.1|GH75	4.38e-101	1	230	11	241
QMW34800.1|GH75	4.38e-101	1	230	11	241
BAE64590.1|GH75	4.38e-101	1	230	11	241

PDB Hits     

EKG14749.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	5.43e-107	5	230	16	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	7.78e-102	1	230	11	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	5.62e-98	3	230	13	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	5.62e-98	3	230	13	245	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q8NK76|CSNB_ASPOZ	1.11e-96	1	230	11	240	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994436	0.005619

TMHMM  Annotations     

There is no transmembrane helices in EKG14749.1.